GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pimF in Cupriavidus basilensis 4G11

Align 6-carboxyhex-2-enoyl-CoA hydratase (characterized)
to candidate RR42_RS35270 RR42_RS35270 3-hydroxyacyl-CoA dehydrogenase

Query= metacyc::MONOMER-20678
         (699 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS35270 RR42_RS35270
           3-hydroxyacyl-CoA dehydrogenase
          Length = 693

 Score =  719 bits (1855), Expect = 0.0
 Identities = 374/693 (53%), Positives = 492/693 (70%), Gaps = 6/693 (0%)

Query: 1   MSEVVTRATQDQVAIVTVDSPPVNALSAAVRRGILENVNAAVADPAVQAIVLVCAGRTFI 60
           ++ V   A + ++AI+T++SPPVNALSAAVR GIL  +  A+AD  V+ IVL CAG+TFI
Sbjct: 4   INAVADLAVEGEIAILTLNSPPVNALSAAVRAGILAGIERAIADSNVRGIVLTCAGKTFI 63

Query: 61  AGADITEFGKPPQPPALNDVIAALENSPKPTIAAIHGTALGGGLEVALGCHFRVAVKEAK 120
           AGADITEFGKPP  P+L DV AA+E SPKP +AAIHGTALGGGLEVAL CH+RVA + A+
Sbjct: 64  AGADITEFGKPPVGPSLADVQAAIEGSPKPVVAAIHGTALGGGLEVALVCHYRVAARSAR 123

Query: 121 LGLPEVKLGLLPGAGGTQRLPRAVGPELAVQMIVGGSPIGAAEALKHGLVEEVVEN--LV 178
            GLPEV LGLLPGAGGTQRLPR VGP  A+ M+  G+ IGAA A + GL + V E+  L 
Sbjct: 124 CGLPEVNLGLLPGAGGTQRLPRIVGPAKALDMVTSGAHIGAAAAAEMGLFDLVTEDAALR 183

Query: 179 AGAVAFAKKVLAEKRPLRRLRDDDSKLAAAKADRSIFTNAVAAMTKKARGLEAPFACADA 238
           A A+AFA++V AE+RPLR++RD + K+ AA+    +F +   A  +K RG +AP      
Sbjct: 184 ASAIAFARQVNAEQRPLRKVRDLNEKVEAARGKPELFADFRRANARKFRGFDAPEYNIRC 243

Query: 239 IGAAIDLPFEEGLKKEREGFMKLVVSDQSKAQRYAFFAEREAAKVDGVPDGTKPRPVSRV 298
           I AA++LPF+EG+K ER+ F++L+   QS AQRY FFA R+   V  VP  T    V +V
Sbjct: 244 IEAAVNLPFDEGMKVERKLFLELMNGTQSAAQRYYFFASRQVWNVPDVPADTPVIDVKKV 303

Query: 299 AIIGAGTMGGGIAMSFANAGIPVTLIETGEEQLKRGLGIMQKNWEATAARGGLPPDAPAK 358
            IIGAGTMGGGIAM+  NAGIPV ++ET ++ L RG+  ++ N++ TA +G +      +
Sbjct: 304 GIIGAGTMGGGIAMNMLNAGIPVVIVETAQQALDRGVRTIRANYDNTAKKGRITAADVDR 363

Query: 359 RMALITGLVGLENVKDADLIIEAVFETMAVKKEVFTAVDAHAKPGAVLASNTSYLSIDEI 418
           RMAL+T  + L  + DADL+IEAV+E M VKK++F  +D   KPGA+LA+NTS L ++EI
Sbjct: 364 RMALLTPTLELGQLADADLVIEAVYENMDVKKDIFGKLDKIVKPGAILATNTSALDVNEI 423

Query: 419 AATTKRPQDVLGMHFFSPANVMKLCEIVRGAKTAPDALLTAVSIAKKIAKVPVVVGVCDG 478
           A  T RP+ V+G+HFFSPANVMKL E+VRG KTA   + T++ +A+KI K+  +VGVC G
Sbjct: 424 ARATSRPESVIGLHFFSPANVMKLLEVVRGDKTAKPVIRTSMELARKIGKIAALVGVCPG 483

Query: 479 FVGNRMLAARSKQSEKLLFEGALPQQVDAVVTKFGMPMGPFAMGDLAGLDIGWRSRKDRG 538
           FVGNRMLA R ++++KL+ EGALP  +D V+  FG PMGPFAM DLAGLD+GW   +++ 
Sbjct: 484 FVGNRMLAQRQREAQKLVLEGALPWDIDRVLYNFGFPMGPFAMSDLAGLDLGW--IREKS 541

Query: 539 IKSEIADALCEAGRFGQKTGKGYYKYEQGSRAPMPDPEVETLINDTLAKLGLKRRDITDE 598
             + + + LCE  R GQKTG GYY Y++  R  +P P VE +I D  A+ G   R + ++
Sbjct: 542 SSATLREILCEMDRRGQKTGAGYYDYDE-KRNAIPSPVVEGIIRDFAARQGKTSRVVCEQ 600

Query: 599 EILERMVYPMINEGARILEEKIAARPSDIDVVWLYGYGWPIYRGGPMHYADSVGLKHIAE 658
           EILER +YPMINEGA+ILEE  A R SDIDVVW+ GYGWP+YRGGPM YAD++GL  +  
Sbjct: 601 EILERCIYPMINEGAKILEEGKAIRASDIDVVWVNGYGWPVYRGGPMCYADTIGLDKVLA 660

Query: 659 RLSAYAKATNDPSLEPAPLLARLAAEGKTFASL 691
            +  + +AT     +PA LL  L A+GK F+ L
Sbjct: 661 VMKNF-EATLGADFKPARLLEDLVAQGKKFSDL 692


Lambda     K      H
   0.317    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1122
Number of extensions: 58
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 699
Length of database: 693
Length adjustment: 39
Effective length of query: 660
Effective length of database: 654
Effective search space:   431640
Effective search space used:   431640
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory