Align Phenylalanine:H+ symporter, PheP of 458 aas and 12 established TMSs (characterized)
to candidate RR42_RS05070 RR42_RS05070 amino acid permease
Query= TCDB::P24207 (458 letters) >FitnessBrowser__Cup4G11:RR42_RS05070 Length = 466 Score = 303 bits (775), Expect = 1e-86 Identities = 161/444 (36%), Positives = 248/444 (55%), Gaps = 6/444 (1%) Query: 15 QEPTLHRGLHNRHIQLIALGGAIGTGLFLGIGPAIQMAGPAVLLGYGVAGIIAFLIMRQL 74 +E LHR L + +IA+GGAIGTGLF+G G AI AGP VLL Y + ++ L+M L Sbjct: 4 REQGLHRSLKPAQLAMIAIGGAIGTGLFMGSGFAIGFAGPGVLLSYAIGALVTLLLMGCL 63 Query: 75 GEMVVEEPVSGSFAHFAYKYWGPFAGFLSGWNYWVMFVLVGMAELTAAGIYMQYWFPDVP 134 EM V P SGSF +A Y P AGFL + YW VL E+TA +YM YWFP VP Sbjct: 64 AEMTVAHPTSGSFGAYAEHYVSPLAGFLVRYAYWASIVLAVGTEVTAVALYMGYWFPQVP 123 Query: 135 TWIWAAAFFIIINAVNLVNVRLYGETEFWFALIKVLAIIGMIGFGLWLLF-----SGHGG 189 W W +F + +NLV V ++G E+ F+++K++AI+ I +++F +G G Sbjct: 124 AWFWIVSFSAALILINLVGVGIFGAVEYLFSMVKIVAIVAFILVAAYIVFGAPGSTGSGA 183 Query: 190 EKASIDNLWRYGGFFATGWNGLILSLAVIMFSFGGLELIGITAAEARDPEKSIPKAVNQV 249 A + +GGF G G+ +++ V +FS+ +E+I + A EA+DPE+++ +A Sbjct: 184 AGAGFHHYTAHGGFLPNGLWGMWVAVIVSIFSYLSIEMIAVAAGEAQDPERAVLQAFRST 243 Query: 250 VYRILLFYIGSLVVLLALYPWVEVKSNSSPFVMIFHNLDSNVVASALNFVILVASLSVYN 309 + R+ LFY+ +L ++LA+ PW + + SPFV + + A+ +NFV+L+A+LS N Sbjct: 244 MIRLGLFYLLTLALMLAIVPWNQAGAQKSPFVQVMEAIHVPGAAAIINFVVLIAALSAMN 303 Query: 310 SGVYSNSRMLFGLSVQGNAPKFLTRVSRRGVPINSLMLSGAITSLVVLINYLLPQKAFGL 369 S +Y +R +F L+ G AP+ VS+RG+P+ +L+LS +L +N P AF L Sbjct: 304 SQLYITTRTMFSLARAGQAPRSFGEVSKRGIPVRALLLSSIGIALATGLNVFYPGNAFLL 363 Query: 370 LMALVVATLLLNWIMICLAHLRFRAAMRRQG-RETQFKALLYPFGNYLCIAFLGMILLLM 428 +MA+ + L W MI + H RFR G R F+ +P L + I+L Sbjct: 364 MMAISMFGALFTWFMIFVTHYRFRRQWAAAGNRPLAFRMRGFPLLTLLGAGMMLAIMLTT 423 Query: 429 CTMDDMRLSAILLPVWIVFLFMAF 452 D R++ I ++ L +A+ Sbjct: 424 LLTDAFRMTLITGIPFLAALSVAY 447 Lambda K H 0.329 0.143 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 458 Length of database: 466 Length adjustment: 33 Effective length of query: 425 Effective length of database: 433 Effective search space: 184025 Effective search space used: 184025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory