Align Branched chain amino acid ABC transporter substrate-binding protein (characterized, see rationale)
to candidate RR42_RS20120 RR42_RS20120 amino acid ABC transporter substrate-binding protein
Query= uniprot:A0A165KTD4 (375 letters) >FitnessBrowser__Cup4G11:RR42_RS20120 Length = 383 Score = 328 bits (842), Expect = 1e-94 Identities = 177/375 (47%), Positives = 242/375 (64%), Gaps = 7/375 (1%) Query: 4 KLKLTVVAAIAA--AAGVASAQEQVVKIGHVAPVSGAQAHYGKDNENGARMAIEELNAQG 61 K LTV ++A A A AQ Q +K+G AP++G QA YGKD +NG +AIEE+NA Sbjct: 7 KTALTVALSVAGLCATSAAFAQAQEIKLGFAAPMTGGQAQYGKDMQNGVVLAIEEMNATK 66 Query: 62 VTIGGKKIKFELVAEDDAADPKQGTAAAQKLCDAKVAGVVGHLNSGTTIPASKVYNDCGI 121 IGGK +KF L++EDDAADPK G+ AQKL D + G++GH NSGT+IPAS VYN GI Sbjct: 67 PKIGGKDVKFVLLSEDDAADPKTGSVVAQKLVDNGIQGMLGHFNSGTSIPASMVYNRAGI 126 Query: 122 PHVTGAATNPNLTKPGYKTTFRIIANDNALGAGLAFYAVDTLKLKTVAIIDDRTAYGQGV 181 P + AT P T+ G+KTTFR++ +D G+ + + V L K +AI+DDRTAYGQG+ Sbjct: 127 PQI-AMATAPEYTRQGFKTTFRMMTSDTQQGSVIGAFVVKKLGAKNIAIVDDRTAYGQGL 185 Query: 182 ADVFKKTATAKGMKVVDEQFTTDKATDFMAILTAIKAKNPDAIFYGGMDPQGGPMLRQME 241 AD F+K A A G K+V +FT DKA DF A+LT IK NPD IF+GG + Q PM +Q++ Sbjct: 186 ADEFEKAAKAAGGKIVRREFTNDKAVDFKAVLTNIKRSNPDVIFFGGAETQSAPMAKQVK 245 Query: 242 QLGMGNVKYFGGDGICTSEIAKLAAGAKTLGNVICAEGGSSLAKMPGGTAWKAKYDAKYP 301 +LGM + G+ T KL AG G V+ + G L +MPGGTA++ KY+ ++ Sbjct: 246 ELGMKS-PVVSGEMSKTDNFLKL-AGPAAEGTVV-SLAGLPLEQMPGGTAYEKKYEKRFG 302 Query: 302 NQFQVYSPYTYDATFLIVDAMKRANSVDPKVYTPELAKSSFKGVTS-TIAFEPNGEMKNP 360 ++ Q YSPY YD ++ AM +A S DP Y P LA ++ +GVT+ T+A++ G++K+ Sbjct: 303 SKVQTYSPYAYDGATALMTAMIKAGSADPARYLPVLAATNMQGVTTKTLAYDARGDLKDG 362 Query: 361 AITLYVYKDGKKTPL 375 IT+Y GK T L Sbjct: 363 GITVYKVVGGKWTVL 377 Lambda K H 0.315 0.131 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 469 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 383 Length adjustment: 30 Effective length of query: 345 Effective length of database: 353 Effective search space: 121785 Effective search space used: 121785 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory