Align Maleylacetoacetate isomerase (EC 5.2.1.2) (characterized)
to candidate RR42_RS01970 RR42_RS01970 maleylacetoacetate isomerase
Query= reanno::MR1:200836 (216 letters) >FitnessBrowser__Cup4G11:RR42_RS01970 Length = 214 Score = 260 bits (665), Expect = 1e-74 Identities = 130/217 (59%), Positives = 161/217 (74%), Gaps = 6/217 (2%) Query: 1 MILYGYWRSSAAYRVRIALNLKGVSAEQLSVHLVRDGGEQHKADYIALNPQELVPTLVVD 60 M LY Y+RSSA+YRVRIAL LKG+ E + VHL+RDGG+Q Y ALNP LVPTL+ D Sbjct: 1 MKLYSYFRSSASYRVRIALQLKGLPYEYMPVHLLRDGGQQLLPAYRALNPDALVPTLLDD 60 Query: 61 DEQDGDALTQSLAIIEYLDELYPKTPLLPASALERAHVRAMALTIACEIHPLNNLRVLQY 120 D L QS+A++EYLDE +P+ PLLP SAL+RA++RA+AL +ACEIHPLNNLRVL+Y Sbjct: 61 DH----VLIQSVAMVEYLDETHPEPPLLPGSALDRAYIRALALEVACEIHPLNNLRVLKY 116 Query: 121 LTQKLTVNEEAKSAWYHHWVATGFTALETQLVR--HSGRYCFGDKVTIADLCLVPQVYNA 178 + L V EEAK AWY HWV GF ++ T LVR +GR+CFGD T+AD+CLVPQV+NA Sbjct: 117 IKHTLGVTEEAKDAWYRHWVELGFESVNTNLVRSGKAGRFCFGDTPTLADICLVPQVFNA 176 Query: 179 QRFNVDLTPYPNIMRVWAECNQLPAFADAAPERQADA 215 QRFN+D+ YP I +V+ C LPAF A P+ Q DA Sbjct: 177 QRFNIDVARYPAIAKVFDACMALPAFQQAEPKAQPDA 213 Lambda K H 0.321 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 3 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 216 Length of database: 214 Length adjustment: 22 Effective length of query: 194 Effective length of database: 192 Effective search space: 37248 Effective search space used: 37248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate RR42_RS01970 RR42_RS01970 (maleylacetoacetate isomerase)
to HMM TIGR01262 (maiA: maleylacetoacetate isomerase (EC 5.2.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01262.hmm # target sequence database: /tmp/gapView.27339.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01262 [M=211] Accession: TIGR01262 Description: maiA: maleylacetoacetate isomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-90 288.7 0.0 1.5e-90 288.5 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS01970 RR42_RS01970 maleylacetoacetate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS01970 RR42_RS01970 maleylacetoacetate isomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 288.5 0.0 1.5e-90 1.5e-90 1 210 [. 2 213 .. 2 214 .] 0.98 Alignments for each domain: == domain 1 score: 288.5 bits; conditional E-value: 1.5e-90 TIGR01262 1 klYsyfrSsasyRvRiaLaLkgidyesvpvnLlkd.GeqkkeefkalNPqelvPtLkidegevltqSlA 68 klYsyfrSsasyRvRiaL+Lkg+ ye++pv+Ll+d G+q ++++alNP +lvPtL +d+ +vl qS+A lcl|FitnessBrowser__Cup4G11:RR42_RS01970 2 KLYSYFRSSASYRVRIALQLKGLPYEYMPVHLLRDgGQQLLPAYRALNPDALVPTLLDDD-HVLIQSVA 69 69*********************************9***********************5.******** PP TIGR01262 69 iieyLeetypepaLlpkdpakrarvralalliacdihPlqNlrvlqlleeklgvdeeekkewlkhwiek 137 ++eyL+et+pep+Llp + +ra ralal +ac+ihPl+Nlrvl++++++lgv ee+k++w++hw+e lcl|FitnessBrowser__Cup4G11:RR42_RS01970 70 MVEYLDETHPEPPLLPGSALDRAYIRALALEVACEIHPLNNLRVLKYIKHTLGVTEEAKDAWYRHWVEL 138 ********************************************************************* PP TIGR01262 138 GlaalEellk..ekagafcvGdevtladvcLvpqvynAerfevdlaqyPtlkrieealaelpafqeahp 204 G++++ + l kag+fc+Gd++tlad+cLvpqv nA+rf++d+a+yP++ ++ +a+ +lpafq+a+p lcl|FitnessBrowser__Cup4G11:RR42_RS01970 139 GFESVNTNLVrsGKAGRFCFGDTPTLADICLVPQVFNAQRFNIDVARYPAIAKVFDACMALPAFQQAEP 207 *****998876889******************************************************* PP TIGR01262 205 enqpdt 210 + qpd+ lcl|FitnessBrowser__Cup4G11:RR42_RS01970 208 KAQPDA 213 *****7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (214 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.43 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory