GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaJ2 in Cupriavidus basilensis 4G11

Align 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized, see rationale)
to candidate RR42_RS35915 RR42_RS35915 beta-ketoadipyl CoA thiolase

Query= uniprot:B2SYZ2
         (400 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS35915 RR42_RS35915
           beta-ketoadipyl CoA thiolase
          Length = 400

 Score =  629 bits (1623), Expect = 0.0
 Identities = 311/400 (77%), Positives = 352/400 (88%)

Query: 1   MNDAFICDAIRTPIGRYGGALKDVRADDLGAVPIKALIERNPGVDWRTVDDVIYGCANQA 60
           M +AFICDAIRTPIGRY G+L  VR DDLGAVP+KAL+ RNP +DW  +DDVIYG ANQA
Sbjct: 1   MTEAFICDAIRTPIGRYAGSLSGVRPDDLGAVPLKALMARNPNLDWSAIDDVIYGNANQA 60

Query: 61  GEDNRNVARMSALLAGLPVEAPGSTINRLCGSGMDAVGTAARAIKAGEARLMIAGGVESM 120
           GEDNRNVARMS LLAGLP   PG+TINRLCGSGMDA GTAARAIK+GEA LM+AGGVESM
Sbjct: 61  GEDNRNVARMSLLLAGLPQSVPGATINRLCGSGMDATGTAARAIKSGEAGLMLAGGVESM 120

Query: 121 TRAPFVMGKATSAFARQADIYDTTIGWRFINPLMKRQYGVDSMPETAENVAAEFSVSRAD 180
           +RAPFVMGKATSAF+R A I+DTTIGWRFINP M+  YGVDSMPETAENVA ++ +SR D
Sbjct: 121 SRAPFVMGKATSAFSRDAQIFDTTIGWRFINPAMRAAYGVDSMPETAENVATDYKISRED 180

Query: 181 QDAFALASQQKAARAQQDGTLAQEIVGVEIAQKKGDPVRALLDEHPRETSLESLGKLKGV 240
           QD  AL SQ+KA+RAQ DGTLAQEI  V IAQKKGDP+    DEHPR TS+E+LGKL+GV
Sbjct: 181 QDLMALRSQEKASRAQADGTLAQEITAVTIAQKKGDPLVVERDEHPRATSMEALGKLRGV 240

Query: 241 VRPDGSVTAGNASGVNDGACALLLANQQAADQYGLRRRARVVGMATAGVEPRIMGIGPAP 300
           VR DG+VTAGNASGVNDGACA+LLA++ AA Q+GL  +AR+VGMATAGV PR+MGIGPAP
Sbjct: 241 VRADGTVTAGNASGVNDGACAILLASEAAARQHGLTPKARIVGMATAGVAPRVMGIGPAP 300

Query: 301 ATQKLLKQLGMTLEQLDVIELNEAFASQGLAVLRTLGLRDDDPRVNPNGGAIALGHPLGA 360
           A+QKLLKQLGMT++Q+DVIELNEAFA+QGLAVLR LG+ DDD RVNPNGGAIALGHPLG 
Sbjct: 301 ASQKLLKQLGMTIDQMDVIELNEAFAAQGLAVLRELGVADDDARVNPNGGAIALGHPLGM 360

Query: 361 SGARLITTALYQLERTNGRFALCTMCIGVGQGIALVIERL 400
           SGARL+TTA+YQL RT GR+ALCTMCIGVGQGIA+VIER+
Sbjct: 361 SGARLVTTAMYQLHRTGGRYALCTMCIGVGQGIAMVIERV 400


Lambda     K      H
   0.318    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 588
Number of extensions: 17
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 400
Length adjustment: 31
Effective length of query: 369
Effective length of database: 369
Effective search space:   136161
Effective search space used:   136161
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate RR42_RS35915 RR42_RS35915 (beta-ketoadipyl CoA thiolase)
to HMM TIGR02430 (pcaF: 3-oxoadipyl-CoA thiolase (EC 2.3.1.174))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02430.hmm
# target sequence database:        /tmp/gapView.11954.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02430  [M=400]
Accession:   TIGR02430
Description: pcaF: 3-oxoadipyl-CoA thiolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   4.7e-223  726.4  13.2   5.2e-223  726.2  13.2    1.0  1  lcl|FitnessBrowser__Cup4G11:RR42_RS35915  RR42_RS35915 beta-ketoadipyl CoA


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Cup4G11:RR42_RS35915  RR42_RS35915 beta-ketoadipyl CoA thiolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  726.2  13.2  5.2e-223  5.2e-223       2     400 .]       3     400 .]       2     400 .] 1.00

  Alignments for each domain:
  == domain 1  score: 726.2 bits;  conditional E-value: 5.2e-223
                                 TIGR02430   2 evyivdairtpiGrygGslssvraddlaavplkallarnpsldaaaiddvilGcanqaGednrnvarma 70 
                                               e++i+dairtpiGry+Gsls vr ddl+avplkal+arnp+ld++aiddvi+G anqaGednrnvarm+
  lcl|FitnessBrowser__Cup4G11:RR42_RS35915   3 EAFICDAIRTPIGRYAGSLSGVRPDDLGAVPLKALMARNPNLDWSAIDDVIYGNANQAGEDNRNVARMS 71 
                                               89******************************************************************* PP

                                 TIGR02430  71 allaGlpvsvpgttvnrlcgsgldalglaaraikaGeadlviaGGvesmsrapfvlGkadsafsrsakl 139
                                               +llaGlp+svpg+t+nrlcgsg+da g+aaraik+Gea l++aGGvesmsrapfv+Gka safsr+a++
  lcl|FitnessBrowser__Cup4G11:RR42_RS35915  72 LLLAGLPQSVPGATINRLCGSGMDATGTAARAIKSGEAGLMLAGGVESMSRAPFVMGKATSAFSRDAQI 140
                                               ********************************************************************* PP

                                 TIGR02430 140 edttiGwrfvnpklkalyGvdsmpetaenvaeefgvsredqdafalrsqqrtaaaqakGffaeeivpve 208
                                               +dttiGwrf+np+++a yGvdsmpetaenva+++++sredqd +alrsq+++++aqa G +a+ei+ v+
  lcl|FitnessBrowser__Cup4G11:RR42_RS35915 141 FDTTIGWRFINPAMRAAYGVDSMPETAENVATDYKISREDQDLMALRSQEKASRAQADGTLAQEITAVT 209
                                               ********************************************************************* PP

                                 TIGR02430 209 ikqkkGeetvvdkdehlraettlealaklkavvredgtvtaGnasGvndGaaalllaseeavkrhgltp 277
                                               i+qkkG++ vv++deh+r  t++eal kl++vvr+dgtvtaGnasGvndGa+a+llase a+++hgltp
  lcl|FitnessBrowser__Cup4G11:RR42_RS35915 210 IAQKKGDPLVVERDEHPR-ATSMEALGKLRGVVRADGTVTAGNASGVNDGACAILLASEAAARQHGLTP 277
                                               ******************.8************************************************* PP

                                 TIGR02430 278 rarilaaasaGveprvmGlgpvpavkkllaraglsledldvielneafaaqalavlrelgladddarvn 346
                                               +ari+++a+aGv+prvmG+gp+pa +kll+++g++++++dvielneafaaq+lavlrelg+adddarvn
  lcl|FitnessBrowser__Cup4G11:RR42_RS35915 278 KARIVGMATAGVAPRVMGIGPAPASQKLLKQLGMTIDQMDVIELNEAFAAQGLAVLRELGVADDDARVN 346
                                               ********************************************************************* PP

                                 TIGR02430 347 pnGGaialGhplGasGarlvltalkqleksggryalatlciGvGqGialvierv 400
                                               pnGGaialGhplG+sGarlv+ta++ql+++ggryal+t+ciGvGqGia+vierv
  lcl|FitnessBrowser__Cup4G11:RR42_RS35915 347 PNGGAIALGHPLGMSGARLVTTAMYQLHRTGGRYALCTMCIGVGQGIAMVIERV 400
                                               *****************************************************8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (400 nodes)
Target sequences:                          1  (400 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 9.91
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory