Align Enoyl-CoA hydratase; EC 4.2.1.17 (characterized, see rationale)
to candidate RR42_RS05755 RR42_RS05755 enoyl-CoA hydratase
Query= uniprot:A0A2Z5MCI7 (262 letters) >FitnessBrowser__Cup4G11:RR42_RS05755 Length = 259 Score = 312 bits (799), Expect = 5e-90 Identities = 161/262 (61%), Positives = 198/262 (75%), Gaps = 3/262 (1%) Query: 1 MSAELLTSRPTESESTLVLTLSNPGARNALHPDMYAAGIEALDSVERDPSIRAVVITGAD 60 M+A+LL+ R ++TLVLT+SNP ARNALHPD+YAA +AL+ RD IRAVVITGAD Sbjct: 1 MTAQLLSERV---DTTLVLTISNPEARNALHPDIYAASQQALELASRDDEIRAVVITGAD 57 Query: 61 NFFCAGGNLNRLLENRAKDPSVQAQSIDLLAEWISALRLSSKPVIAAVDGAAAGAGFSLA 120 FCAGGNLNRLL NRAK VQA+SI++L WI L KP+IAAV+G AAGAGFSL Sbjct: 58 GVFCAGGNLNRLLGNRAKPREVQAESIEVLNHWIETLHAFPKPIIAAVEGPAAGAGFSLV 117 Query: 121 LACDLIVAADDAKFVMSYARVGLTPDGGGSWFLAQALPRQLATEVLIEGKPIGAARLHEL 180 LACD +VAA DAKFVM+Y VGLTPDGGGS+ LA+ALPRQLA+E+++EGKP+ AARL Sbjct: 118 LACDFVVAASDAKFVMAYVNVGLTPDGGGSYELARALPRQLASELIMEGKPVDAARLAHF 177 Query: 181 GVVNKLTKPGTARDAAVAWADELGKISPNSVARIKTLVCAAGTQPLSEHLVAERDNFVAS 240 G+VN++ PG A A+ + L SP+++ RIK L+ A T L+EHL ERDNFVA+ Sbjct: 178 GLVNRVVPPGQALTEALRLGESLATRSPHAMGRIKGLINHAATASLTEHLAQERDNFVAA 237 Query: 241 LHHREGLEGISAFLEKRAPVYK 262 LHH++G EGI AFLEKR P Y+ Sbjct: 238 LHHKDGGEGIGAFLEKRKPNYR 259 Lambda K H 0.317 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 259 Length adjustment: 25 Effective length of query: 237 Effective length of database: 234 Effective search space: 55458 Effective search space used: 55458 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory