Align L-proline and D-alanine ABC transporter, permease component 1 (characterized)
to candidate RR42_RS14420 RR42_RS14420 branched-chain amino acid transporter permease subunit LivH
Query= reanno::azobra:AZOBR_RS08235 (301 letters) >FitnessBrowser__Cup4G11:RR42_RS14420 Length = 308 Score = 359 bits (922), Expect = e-104 Identities = 185/301 (61%), Positives = 231/301 (76%), Gaps = 3/301 (0%) Query: 4 FLQQLINGLSLGAIYGLIAIGYTMVYGIIGMINFAHGEIYMIGAFVALITFLAIGSLGIT 63 F QQL+NGL+LGAIY LIAIGYTMVYGIIGMINFAHGEIYMIGA+V L+T AIG+ Sbjct: 8 FTQQLVNGLTLGAIYALIAIGYTMVYGIIGMINFAHGEIYMIGAYVGLVTLTAIGASAGY 67 Query: 64 WVPLALLVMLVASMLFTAVYGWTVERIAYRPLRSSPRLAPLISAIGMSIFLQNYVQILQG 123 +PL L L+ S+L T +YG+ VER+AYRPLR PRL PLISAIGMSIFLQNYVQI QG Sbjct: 68 PLPLVLGAALLVSVLVTGLYGFAVERVAYRPLRGGPRLVPLISAIGMSIFLQNYVQIGQG 127 Query: 124 ARSKPLQPILPGNLTLMDGA---VSVSYVRLATIVITIALMYGFTQLITRTSLGRAQRAC 180 AR + ++ G + G+ V+V Y RL + +T+ LM T I + +GRA RAC Sbjct: 128 ARDMSVPVLISGAIEFQMGSDFTVTVPYSRLLIVGVTLVLMLALTLFIGHSRMGRACRAC 187 Query: 181 EQDKKMAGLLGVNVDRVISLTFVMGAALAAVAGMMVLLIYGVIDFYIGFLAGVKAFTAAV 240 +D +MA LLG++ +RVIS TFV+GA LAAV G+++ L G ++ YIGF+AG+KAFTAAV Sbjct: 188 AEDMRMANLLGIDTNRVISFTFVLGAMLAAVGGVLIGLTIGKLNPYIGFVAGIKAFTAAV 247 Query: 241 LGGIGSLPGAMLGGVVIGLIEAFWSGYMGSEWKDVATFTILVLVLIFRPTGLLGRPEIEK 300 LGGIGS+PGAMLGGV++GL E F SGYM +E+KDV F +LVL+L+FRPTGLLG+P++EK Sbjct: 248 LGGIGSIPGAMLGGVLLGLAETFASGYMPAEYKDVVAFGLLVLILLFRPTGLLGKPDVEK 307 Query: 301 V 301 V Sbjct: 308 V 308 Lambda K H 0.329 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 426 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 308 Length adjustment: 27 Effective length of query: 274 Effective length of database: 281 Effective search space: 76994 Effective search space used: 76994 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory