Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate RR42_RS00195 RR42_RS00195 ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >FitnessBrowser__Cup4G11:RR42_RS00195 Length = 309 Score = 211 bits (536), Expect = 2e-59 Identities = 110/310 (35%), Positives = 195/310 (62%), Gaps = 4/310 (1%) Query: 1 MDIFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQV 60 M + Q + NGL+LG +YA++A+G+T+ +GVL++I F+HGD LMVGA GL+ V + Sbjct: 1 MSVIGQYVFNGLMLGMIYAMVAVGFTLFFGVLDVIKFSHGDTLMVGAFAGLAASTGVLML 60 Query: 61 APGLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAM 120 P I +L+ ++ AI V ++ I + PLR A L L+ + + +++ Sbjct: 61 DIQSPWI-RLLAVVLCAICVTGLLGAAIAKFLILPLRKAAPLNTLLATLMLGTVMRESVR 119 Query: 121 MIW--GRSPLPFPQVMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRAMR 178 + + G +P PFP ++P+ + + + ++LLA + +VG+ L++ +T+ G A+R Sbjct: 120 LFYPDGSNPKPFPALLPTASIELGSLSLRADNLILLATGIAIIVGVHLLITRTRFGMAIR 179 Query: 179 ATAENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAFSA 238 A A++ A LMG++ V+++TFA+G+G+AA+AGVM Y+ F +G + G+ F+A Sbjct: 180 AVAQDGETARLMGINFEAVVLLTFALGSGMAALAGVMNGLYYNEINFNVGLLLGVIGFAA 239 Query: 239 AVLGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLRPS 298 A+LGG+GNIYGA+LGG L ++ LG+ + L + + S Y+D+FAF V+I+++ +P+ Sbjct: 240 AILGGLGNIYGAILGGFLFAALQVLGSATLPALIPD-IPSAYKDVFAFAVVIVLMAWKPT 298 Query: 299 GIMGERVADR 308 G++ E+ ++R Sbjct: 299 GLIAEKSSER 308 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 309 Length adjustment: 27 Effective length of query: 282 Effective length of database: 282 Effective search space: 79524 Effective search space used: 79524 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory