Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate RR42_RS34785 RR42_RS34785 ABC transporter permease
Query= uniprot:D8IUY4 (309 letters) >FitnessBrowser__Cup4G11:RR42_RS34785 Length = 287 Score = 193 bits (491), Expect = 4e-54 Identities = 112/310 (36%), Positives = 182/310 (58%), Gaps = 27/310 (8%) Query: 1 MDIFIQQIINGLVLGSMYALIALGYTMVYGVLNLINFAHGDILMVGAMVGLSLLKVVQQV 60 M +F+QQ++NGL LG +Y+L+ALG T+VYG+L++ NFAHG M GA V L+ + Sbjct: 1 MTLFLQQVLNGLTLGGVYSLVALGLTLVYGILHVPNFAHGAFYMAGAYVSYYLMTSLG-- 58 Query: 61 APGLPGIVQLVIAIVGAIPVCIVVSLLIERIAYRPLRNAPRLAPLITAIGVSILLQTLAM 120 + +A+ A V+S+L +R+ + PLRNAP L +I AIG+ + L+ A Sbjct: 59 -------MNYWLAMGAAAIAVAVLSMLADRLVFHPLRNAPELHDMIAAIGIMLFLEAGAQ 111 Query: 121 MIWG----RSPLPFPQVMPSDPVHIAGALISPTQIMLLALAVLAMVGLVLIVEKTKMGRA 176 +WG R P P+ Q+ V + G +++++A A MV L L + +T G Sbjct: 112 AMWGADFHRMPTPYGQM-----VEVMGLSAPAQRLLIIAAAFGLMVLLHLFLTRTVTGST 166 Query: 177 MRATAENPRIAGLMGVDANKVIVVTFAIGAGLAAIAGVMWAANYSTAQFAMGFVPGLKAF 236 + A A+N A L+G+DA +V ++ FAI LAAIA ++A + +MG + KAF Sbjct: 167 IVAMAQNREGAALVGIDATRVTLLVFAISGALAAIAATLYAP-INLVYPSMGNLVITKAF 225 Query: 237 SAAVLGGIGNIYGAMLGGILLGLIESLGAGYIGDLTGNFLGSNYQDIFAFIVLIIVLTLR 296 +LGG+G+I GA++GG+++G+ ES G G ++ ++Y+DI AF +L+++L++R Sbjct: 226 VIIILGGMGSIPGAIVGGLIIGMAESFG--------GFYVSTDYKDIIAFALLVLILSIR 277 Query: 297 PSGIMGERVA 306 P G+ + A Sbjct: 278 PQGLFAGKAA 287 Lambda K H 0.328 0.144 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 287 Length adjustment: 26 Effective length of query: 283 Effective length of database: 261 Effective search space: 73863 Effective search space used: 73863 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory