GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HSERO_RS00890 in Cupriavidus basilensis 4G11

Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate RR42_RS14415 RR42_RS14415 leucine/isoleucine/valine transporter permease subunit

Query= uniprot:A0A165KER0
         (358 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS14415 RR42_RS14415
           leucine/isoleucine/valine transporter permease subunit
          Length = 424

 Score =  265 bits (676), Expect = 2e-75
 Identities = 163/364 (44%), Positives = 217/364 (59%), Gaps = 49/364 (13%)

Query: 5   KTNWIIGAVALLVLPLILQSFGNAWVRIADLALLYVLLALGLNIVVGYAGLLDLGYVAFY 64
           K  W++ AV L V P          V +A LAL+YV+L LGLNIVVGYAGLLDLGYV FY
Sbjct: 98  KVIWLLLAVGL-VFPFFSS---RGAVDVATLALIYVILGLGLNIVVGYAGLLDLGYVGFY 153

Query: 65  AVGAYLFALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLKLR 124
           AVG Y +AL+           F   F        W  +P+AA ++A FG +LG P L+LR
Sbjct: 154 AVGGYTYALLNQ--------YFGLTF--------WECLPIAAGMSALFGFVLGFPVLRLR 197

Query: 125 GDYLAIVTLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRL-------- 176
           GDYLAIVTLGFGEIIR+ LNNL    +LT GP G+  I    VFG+++ +          
Sbjct: 198 GDYLAIVTLGFGEIIRLLLNNL---TSLTGGPDGVSGIPKPTVFGIEMARSASVEGVKTF 254

Query: 177 -EVFGFDINS---VTLYYYLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGIN 232
            E+ G+D +    V   Y L L+LV  ++ +  RL    +GRAW A+REDEIA +++G+N
Sbjct: 255 HELLGWDYSGEHMVIFLYLLALLLVGFTLFVTSRLIRMPMGRAWEALREDEIACRSLGLN 314

Query: 233 TRNMKLLAFGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVIL 292
              +KL AF +GA+F G+ GA F A QG V+PESF+ +ES +I+A+VVLGG+G   GVIL
Sbjct: 315 PTRIKLSAFTLGAAFAGLGGAFFAARQGLVNPESFTFIESALILAVVVLGGMGSQLGVIL 374

Query: 293 GAVLLSALPEVLRYVAGPLQAMTDGRLDSAILRQLLIALAMIIIMLLRPRGLWPSPEHGK 352
            A+LL+ALPE+ R                A  R L+  L M+++M+ RP+GL P+     
Sbjct: 375 AAILLTALPEMAR--------------GFAEYRMLIFGLVMVLMMMWRPQGLLPASRPHV 420

Query: 353 SLTQ 356
            L Q
Sbjct: 421 ELPQ 424


Lambda     K      H
   0.328    0.144    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 411
Number of extensions: 19
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 358
Length of database: 424
Length adjustment: 30
Effective length of query: 328
Effective length of database: 394
Effective search space:   129232
Effective search space used:   129232
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory