GapMind for catabolism of small carbon sources

 

Aligments for a candidate for HSERO_RS00890 in Cupriavidus basilensis 4G11

Align ABC-type branched-chain amino acid transport system, permease component protein (characterized, see rationale)
to candidate RR42_RS16970 RR42_RS16970 ABC transporter ATP-binding protein

Query= uniprot:D8IUY5
         (404 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS16970 RR42_RS16970 ABC
           transporter ATP-binding protein
          Length = 386

 Score =  454 bits (1168), Expect = e-132
 Identities = 230/383 (60%), Positives = 284/383 (74%), Gaps = 23/383 (6%)

Query: 8   MKRNPQQARISLLLLLALMIVFPFVAQQFG-NSWVRIMDVALLYIMLALGLNVVVGFAGL 66
           + + P +   +LL  L + +  PF+ Q  G N WVR++D AL+YIMLALGLN+VVGFAGL
Sbjct: 15  LTKTPAKTMAALLGFLIIALCAPFLVQTLGGNYWVRVLDFALIYIMLALGLNIVVGFAGL 74

Query: 67  LDLGYIAFYAIGAYSAGLLASPQFAAVIESFVNTYPSVGNFLVWLCGPEIVQNGIHLSLW 126
           LDLGYIAFYA+GAY   LL SP  A   E     +P                NG+HLS+W
Sbjct: 75  LDLGYIAFYAVGAYMMALLGSPHLANQFEWIHQLFP----------------NGLHLSMW 118

Query: 127 LIVPISAFLAALFGALLGAPTLKLRGDYLAIVTLGFGEIIRIFMNNLNAPVNITNGPQGI 186
            ++P++  +AA FG LLGAPTLKLRGDYLAIVTLGFGEIIRIF+NNL+ P+NITNGP+GI
Sbjct: 119 FVLPLAVLVAATFGVLLGAPTLKLRGDYLAIVTLGFGEIIRIFLNNLDRPLNITNGPKGI 178

Query: 187 NLIDPIKVFGVSLAGEPGSGSMVKVFGMSMPSVNAYYFLFLLLCIGVIFFSVRLQDSRLG 246
             +DP+ +FG   +         ++FG+    V  YY+L ++L I ++F  +RLQ+SR+G
Sbjct: 179 TAVDPVHIFGFDFSKSH------EIFGLKFTPVFMYYYLLVVLVIAIVFICLRLQNSRIG 232

Query: 247 RAWVAIREDEIAAKAMGINTRNVKLLAFAMGASFGGVAGAMFGAFQGFVSPESFSLTESI 306
           RA+VAIREDEIAAKAMGINTRN+KLLAFAMGASFGG +GA+FGAFQGFVSPESF L ESI
Sbjct: 233 RAFVAIREDEIAAKAMGINTRNIKLLAFAMGASFGGASGAVFGAFQGFVSPESFVLWESI 292

Query: 307 AVLAMVVLGGIGHIPGVVLGGVILAALPEVLRHVVEPVQMAIFGKVWIDAEVLRQLLYGL 366
            +LA+VVLGG+GHIPGV+LGG++L    E+LR V EP Q  IFG   +DAEVLRQLL+GL
Sbjct: 293 YILAIVVLGGMGHIPGVILGGILLVGFQELLRAVAEPAQNMIFGHTIVDAEVLRQLLFGL 352

Query: 367 AMVVIMLTRPAGLWPSPRHEDRP 389
           A+V +ML RPAGLWPSPR EDRP
Sbjct: 353 ALVGVMLYRPAGLWPSPRKEDRP 375


Lambda     K      H
   0.327    0.143    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 531
Number of extensions: 21
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 404
Length of database: 386
Length adjustment: 31
Effective length of query: 373
Effective length of database: 355
Effective search space:   132415
Effective search space used:   132415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory