Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate RR42_RS20240 RR42_RS20240 hypothetical protein
Query= uniprot:D8J1T6 (255 letters) >FitnessBrowser__Cup4G11:RR42_RS20240 Length = 595 Score = 216 bits (549), Expect = 1e-60 Identities = 117/254 (46%), Positives = 159/254 (62%), Gaps = 6/254 (2%) Query: 3 QTLLKIRDVSKRFGGLQALNGVGITIERGQIYGLIGPNGAGKTTFFNVITGLYQPDTGTF 62 + +L ++ K FGGL A+N V + G+I GLIGPNGAGK+T FN++TG+ G Sbjct: 341 ELILDVKAARKEFGGLVAVNDVSFQVRAGEIIGLIGPNGAGKSTTFNLVTGVLPATRGEV 400 Query: 63 ELDGKPYSPSAPHEVAKAGIARTFQNIRLFGEMTVLENVMVGCHVR----TKQNVFGAVF 118 G+ S E+ K GI RTFQ++ L MTVLENV +G H+R + V A+ Sbjct: 401 LYRGEQISGLPSREIVKRGIGRTFQHVHLLPTMTVLENVAIGAHLRGDFAPQGGVTAAIL 460 Query: 119 RHKAAREEEAAIREKSQKLLDFVGIGQFAKRTARHLSYGDQRRLEIARALATDPQLLALD 178 R + EEA + ++ + L+ VG+ A L+ G QR LEIARAL DP LL LD Sbjct: 461 RMN--KNEEAKLLHEAARQLERVGLADCMYMEAGSLALGQQRILEIARALCCDPALLLLD 518 Query: 179 EPAAGMNATEKLGLRELLVKIQAEGKTILLIEHDVKLMMGLCNRITVLDYGKPIAEGVPA 238 EPAAG+ EK L ELL K++ EG ++LL+EHD+ +M L +R+ V+++G IAEGVP Sbjct: 519 EPAAGLRYKEKQALAELLKKLKGEGMSVLLVEHDMDFVMNLTDRLVVMEFGTRIAEGVPE 578 Query: 239 DVQKNPAVIEAYLG 252 DVQK+PAV+EAYLG Sbjct: 579 DVQKDPAVLEAYLG 592 Lambda K H 0.320 0.138 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 595 Length adjustment: 30 Effective length of query: 225 Effective length of database: 565 Effective search space: 127125 Effective search space used: 127125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory