Align 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-hydroxysteroid dehydrogenase 10; 17-beta-HSD 10; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Scully protein; Type II HADH; EC 1.1.1.35; EC 1.1.1.51; EC 1.1.1.178 (characterized)
to candidate RR42_RS36415 RR42_RS36415 3-hydroxy-2-methylbutyryl-CoA dehydrogenase
Query= SwissProt::O18404 (255 letters) >FitnessBrowser__Cup4G11:RR42_RS36415 Length = 260 Score = 241 bits (614), Expect = 1e-68 Identities = 132/258 (51%), Positives = 173/258 (67%), Gaps = 10/258 (3%) Query: 4 NAVSLVTGGASGLGRATAERLAKQGASVILADLPSSKGNEVAKELGDKVVFVPVDVTSEK 63 + +++TGGASGLG ATA LA G V L D+ + KG VA+ELG VF V+VTSE Sbjct: 6 SVTAVITGGASGLGEATARALAAHGVRVALFDMNAEKGEAVARELGG--VFCQVNVTSEA 63 Query: 64 DVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRL-----EDFQRVININTVG 118 +V A A+ G+ + VNCAGT A+KT + K ++ + F+R+I IN +G Sbjct: 64 EVEAGFAKARAALGQERILVNCAGTGNAIKTASRAKEAPDQIRFFASDAFERIIQINLIG 123 Query: 119 TFNVI-RLSAGLMGANEPNQDGQRGVIVNTASVAAFDGQIGQAAYSASKAAVVGMTLPIA 177 +F + R +AG++ + +DG RGVI+NTASVAA DGQ+GQAAYSASKA VVGMTLPIA Sbjct: 124 SFRCLARSAAGMLTLDA--RDGDRGVIINTASVAAQDGQMGQAAYSASKAGVVGMTLPIA 181 Query: 178 RDLSTQGIRICTIAPGLFNTPMLAALPEKVRTFLAKSIPFPQRLGEPSEYAHLVQAIYEN 237 RDLS +GIR+ TI PG+FNTP+L E V+ LA S+PFP+RLG P E+A L + N Sbjct: 182 RDLSGEGIRVNTIMPGIFNTPLLQGAQEHVKAALAASVPFPKRLGAPEEFASLALEMCRN 241 Query: 238 PLLNGEVIRIDGALRMMP 255 NGE +R+DGA+RM P Sbjct: 242 SYFNGEAVRLDGAIRMAP 259 Lambda K H 0.317 0.133 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 260 Length adjustment: 24 Effective length of query: 231 Effective length of database: 236 Effective search space: 54516 Effective search space used: 54516 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory