Align NatA aka BRAF aka SLR0467, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate RR42_RS25025 RR42_RS25025 sugar ABC transporter ATPase
Query= TCDB::Q55164 (267 letters) >FitnessBrowser__Cup4G11:RR42_RS25025 Length = 256 Score = 181 bits (458), Expect = 2e-50 Identities = 97/251 (38%), Positives = 149/251 (59%), Gaps = 6/251 (2%) Query: 18 LLLAQGLSKSFGGLRAVDHADIVVKEGSITGLIGPNGAGKTTLFNLLSNFIRPDQGEVLF 77 +L +++SFGG+ A+ + G+ITGLIGPNGAGK+T+ NL+ + G VL Sbjct: 8 MLRLDEVARSFGGVPALSGLSLSAAPGTITGLIGPNGAGKSTVVNLVMGLLHLSSGRVLL 67 Query: 78 NGDSIGQLAPHQIALRGSVRTFQVAKVLSRLTVLENMLLADQHQTGEKFLPRLINFRRVQ 137 +G + + Q+A G RTFQ +++ + TVL+N+L F L+ R + Sbjct: 68 DGRDVSTMEASQLARAGVARTFQNIRLVPQATVLDNVLAGFHRHQTTGFWANLLGLRAAR 127 Query: 138 KEERANREKAMAMLESVGLGAKAQDYAGALSGGQRKLLEMARALMSNPKLILLDEPAAGV 197 E A+R +A+A+LE G+ AQ AG LS G ++ +EM RAL P+L+LLDEP AG+ Sbjct: 128 AETAAHRAEAIALLERFGMAKLAQHRAGNLSYGHQRRIEMMRALAMKPRLLLLDEPVAGM 187 Query: 198 N---PTLIGQICEHIVNWNRQGITFLVIEHNMDVIMTLCHHVWVLAEGRNLADGTPEQIQ 254 N +G+I + + +G+ L+IEHNM + +C +++VLA GR +A+G PE + Sbjct: 188 NDVEAASLGRIFQEVA---AEGVAVLLIEHNMRFMTQVCSYLYVLASGREIAEGQPEAVL 244 Query: 255 SDPRVLEAYLG 265 DP V++AYLG Sbjct: 245 QDPVVMQAYLG 255 Lambda K H 0.319 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 256 Length adjustment: 25 Effective length of query: 242 Effective length of database: 231 Effective search space: 55902 Effective search space used: 55902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory