Align NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate RR42_RS29455 RR42_RS29455 ABC transporter ATP-binding protein
Query= TCDB::Q8YT15 (247 letters) >FitnessBrowser__Cup4G11:RR42_RS29455 Length = 261 Score = 199 bits (506), Expect = 5e-56 Identities = 114/236 (48%), Positives = 150/236 (63%), Gaps = 4/236 (1%) Query: 10 PLLEVENVHAGYIKDVDILQGVNFRVESGELVTVIGPNGAGKSTLAKTIFGLLTPHTGKI 69 P+L + NV + Y V ++GV+ V+ G + TV+G NGAGK+T+ KTI G+L P G I Sbjct: 8 PVLALANVESAY-GPVKAIRGVSLAVQRGSIATVLGANGAGKTTILKTISGVLDPTRGSI 66 Query: 70 TFKGKNIAGLKSNQIVRLGMCYVPQIANVFPSLSVEENLEMGAFIRNDSLQPLKD--KIF 127 TFKG++IA + QIVR G+ +VP+ VFP LSV +NL MGA+ R D +D ++ Sbjct: 67 TFKGESIAAMDPAQIVRRGLSHVPEGREVFPLLSVRDNLLMGAYTRRDRDGVARDMEMVY 126 Query: 128 AMFPRLSDRRRQRAGTLSGGERQMLAMGKALMLEPSLLVLDEPSAALSPILVTQVFEQVK 187 FP L +R Q AG LSGG++QMLA+ +ALM P L++LDEPS LSP L +FE V Sbjct: 127 DYFPVLRERAAQDAGLLSGGQQQMLAISRALMAAPELILLDEPSLGLSPKLTKDIFEIVV 186 Query: 188 QINQE-GTAIILVEQNARKALEMADRGYVLESGRDAISGPGQELLTDPKVAELYLG 242 +IN+E GT I+LVEQNA AL AD GYVLE+GR L + E YLG Sbjct: 187 RINRERGTTILLVEQNANMALNAADYGYVLENGRIVAEDTCAVLREKDDIKEFYLG 242 Lambda K H 0.317 0.136 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 261 Length adjustment: 24 Effective length of query: 223 Effective length of database: 237 Effective search space: 52851 Effective search space used: 52851 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory