Align BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized)
to candidate RR42_RS12250 RR42_RS12250 sulfate ABC transporter ATP-binding protein
Query= TCDB::Q9RQ06 (407 letters) >FitnessBrowser__Cup4G11:RR42_RS12250 Length = 374 Score = 162 bits (409), Expect = 2e-44 Identities = 93/279 (33%), Positives = 155/279 (55%), Gaps = 24/279 (8%) Query: 34 ILKKTGATVGVYDTNFEINEGEIFVIMGLSGSGKSTLLRLLNRLIEPTSGKIFIDDQDVA 93 + K G V + D + +EG++ ++G SG GK+TLLR++ L +G+I ++ +D + Sbjct: 8 VQKHFGNFVALDDVTLDFDEGQLTALLGPSGCGKTTLLRIIAGLERADAGQILLEGRDAS 67 Query: 94 TLNKEDLLQVRRKSMSMVFQNFGLFPHRTILENTEYGLEVQNVPKEER------RKRAEK 147 + VR++ + VFQ++ LF H T+ EN +GL V+ P+ ER R + Sbjct: 68 HQH------VRQRQVGFVFQHYALFKHMTVFENVAFGLRVK--PRAERPGEAQIRDKVRA 119 Query: 148 ALDNANLLDFKDQYPKQLSGGMQQRVGLARALANDPEILLMDEAFSALDPLIRREMQDEL 207 L+ L D+YP QLSGG +QR+ LARALA +P +LL+DE F ALD +R+E++ L Sbjct: 120 LLELVQLDWLADRYPPQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWL 179 Query: 208 LELQAKFQKTIIFVSHDLNEALRIGDRIAIMKDGKIMQIGTGEEILTNPANDYVKTFVED 267 L + T +FV+HD EAL + D++ +M G + Q GT E + +PA +V F+ + Sbjct: 180 RRLHDELHVTSVFVTHDQEEALEVADQVVLMNRGHVEQAGTPEAVYNHPATPFVFGFLGN 239 Query: 268 V----------DRAKVITAENIMIPALTTNIDVDGPSVA 296 V +R ++ + ++P + + + G +VA Sbjct: 240 VNLFHGRLEVGERGGLLHTGDSILPVIGSGHETAGDAVA 278 Lambda K H 0.316 0.135 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 301 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 407 Length of database: 374 Length adjustment: 31 Effective length of query: 376 Effective length of database: 343 Effective search space: 128968 Effective search space used: 128968 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory