Align Glycine betaine/proline/ectoine/pipecolic acid transporter OusA; Osmoprotectant uptake system A (characterized)
to candidate RR42_RS29835 RR42_RS29835 hypothetical protein
Query= SwissProt::Q47421 (501 letters) >FitnessBrowser__Cup4G11:RR42_RS29835 Length = 445 Score = 319 bits (817), Expect = 1e-91 Identities = 164/423 (38%), Positives = 254/423 (60%), Gaps = 10/423 (2%) Query: 26 KAITAAALGNAMEWFDFGVYGFVAYALGQVFFPGADPGVQMIAALATFSVPFLIRPLGGV 85 K I+ AA+GN +EWFD+ +YG+++ L +VFFP +DP V +IAA A FSV F+ RPLG + Sbjct: 8 KPISGAAVGNMLEWFDYSLYGYLSATLAKVFFPSSDPIVSLIAAFAAFSVAFVTRPLGAL 67 Query: 86 FFGALGDKYGRQKILAITIIIMSISTFCIGLIPSYERIGIWAPILLLLAKMAQGFSVGGE 145 FFG+LGD+ GR+ LAI + ++S+ST +G++P YE IGI AP+LL+ +M QGFS GGE Sbjct: 68 FFGSLGDRLGRRDTLAIVVGLISVSTGLVGVLPGYEAIGIAAPLLLVALRMIQGFSAGGE 127 Query: 146 YTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGAGVVVLISTLIGEQAFLAWGWRLPF 205 GA F+AEY+P R+RG + + + G + G+G+V+ I+++ G+ A AW WRLPF Sbjct: 128 AGGALAFLAEYAPTRRRGVVIGFFGMSAGIGALSGSGLVLAITSIFGQTAVEAWAWRLPF 187 Query: 206 FLALPLGLIGLYLRHALEETPAFRQHVEKLEQNDRDGLKAGPGVSFREIATHHWKSLLVC 265 +A P+GL +LR +EETPAFR H+E R+G P RE W+S++ C Sbjct: 188 LIAGPIGLGAFWLRLRIEETPAFRLHLE------REGAAQAP---LREALRDDWRSIVKC 238 Query: 266 IGLVIATNVTYYMLLTYMPSYLSHSLHYSENHGVLIIIAIMIGMLFVQPVMGLLSDRFGR 325 +G+ I+ + YY++L Y+PSYL + S + +G + V P LSDR GR Sbjct: 239 LGVAISHGIPYYLILAYLPSYLVSTGRLSSGQALAASGLAFLGSVIVIPFAAALSDRVGR 298 Query: 326 KPFVVIGSVAMFFLAVPSFMLINSDIIGLIFLGLLMLAVILNAFTGVMASTLPALFPTHI 385 +P ++A +A+P F ++ ++ + + V++ + + LFPT Sbjct: 299 RPVAFTAALAYLVVALPLFRIVVGSTPEVVIATMASVGVLMGMYGSAPFCMMTELFPTRT 358 Query: 386 RYSALASAFNIS-VLIAGLTPTVAAWLVESSQNLYMPAYYLMVIAVIGLLTGLFMKETAN 444 RYSA++ +N++ VL G P ++A L + + N PAY++M AV+ + L ET+ Sbjct: 359 RYSAMSVGYNVAMVLFGGTAPLISASLTKLTGNPSSPAYFMMGGAVLSIFAILASPETSR 418 Query: 445 KPL 447 P+ Sbjct: 419 VPI 421 Lambda K H 0.327 0.142 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 549 Number of extensions: 30 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 501 Length of database: 445 Length adjustment: 33 Effective length of query: 468 Effective length of database: 412 Effective search space: 192816 Effective search space used: 192816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory