Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate RR42_RS28050 RR42_RS28050 3-hydroxypropionyl-CoA dehydratase
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__Cup4G11:RR42_RS28050 Length = 261 Score = 167 bits (424), Expect = 2e-46 Identities = 94/243 (38%), Positives = 140/243 (57%), Gaps = 4/243 (1%) Query: 17 ITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKG-KAFCAGADITQFNQLTP 75 +TL+ P LN + L E LDRA+ DP +R +++TG G +AFCAG+DI +F L Sbjct: 20 LTLDNPP-LNVVFRGLTEALDRALDALARDPAVRAVVLTGAGTRAFCAGSDIAEFRPLMR 78 Query: 76 AEAWKFSKKGRE--IMDKIEALSKPTIAMINGYALGGGLELALACDIRIAAEEAQLGLPE 133 K + + +++ KPT+A +NG A GGGLE+A+ CD+ +A E A+ LPE Sbjct: 79 PGQIVPGKLALQHAVFGRLDDFPKPTVAAVNGLAFGGGLEIAVCCDLIVADETARFALPE 138 Query: 134 INLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLEQETRK 193 I LG++PG GG R+TR +G+GRA E+M G+ I A +GLVNRV P Q Sbjct: 139 IKLGVFPGSGGPVRVTRRVGEGRAKELMFLGEPIDAATALAWGLVNRVAPPGQALQAALA 198 Query: 194 LAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFSTEDKKEGVSAFLEKRE 253 LA +A++ P++LAL K+ ++ D+ + VFS+++ +EGV AF + Sbjct: 199 LAATLARRPPLALALCKQAIDLSFDTTEDEAMRQALPLSDRVFSSKEAQEGVRAFFARET 258 Query: 254 PTF 256 P F Sbjct: 259 PRF 261 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 165 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 261 Length adjustment: 24 Effective length of query: 235 Effective length of database: 237 Effective search space: 55695 Effective search space used: 55695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory