GapMind for catabolism of small carbon sources

 

Aligments for a candidate for lctP in Cupriavidus basilensis 4G11

Align L-lactate permease (characterized, see rationale)
to candidate RR42_RS21280 RR42_RS21280 L-lactate permease

Query= uniprot:Q8EIL2
         (545 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS21280 RR42_RS21280 L-lactate
           permease
          Length = 580

 Score =  744 bits (1921), Expect = 0.0
 Identities = 384/571 (67%), Positives = 454/571 (79%), Gaps = 37/571 (6%)

Query: 3   WTQTYTPLGSLWLTAIVALLPIVFFFLALTVLKLKGHIAGALTLLIALAVAIITYKMPVS 62
           WTQTYTPLGSLWL+A+ A LPI+FFFLAL VL++KGH+A A+TLL+AL VAI  Y MPV 
Sbjct: 4   WTQTYTPLGSLWLSALAAALPILFFFLALAVLRMKGHVAAAITLLLALGVAIFAYGMPVP 63

Query: 63  IALASAIYGFSYGLWPIAWIIITAVFLYKITVKTGQFEIIRSSVISVTEDQRLQMLLVGF 122
            ALA+A +GF+YGLWPIAWII+TAVFLYKI VKTGQF+IIR+SV+++T+DQRLQMLL+GF
Sbjct: 64  QALAAAGFGFAYGLWPIAWIIVTAVFLYKIVVKTGQFDIIRASVLAITDDQRLQMLLIGF 123

Query: 123 SFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIANTAPVAFGAMGIPIIVAGQV 182
           +FGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIANTAPVAFGAMGIPIIVAGQV
Sbjct: 124 AFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIANTAPVAFGAMGIPIIVAGQV 183

Query: 183 SSLDPFHIGQLAGRQLPILSIIVPFWLIAMMDGIRGIRQTWPATLVAGVSFAVTQFLTSN 242
           + +D  HIG +AGRQLP+LS+ VPFWL+ +MDG RG+++TWPA LV G SF+VTQ+ TSN
Sbjct: 184 TGIDAMHIGAMAGRQLPLLSLAVPFWLVFIMDGKRGVKETWPAALVTGASFSVTQYFTSN 243

Query: 243 FIGPELPDITSALVSLICLTLFLKVWQPKEIFTFSGMKQRA--------------VTPKS 288
            IGPELPDITSALVSL+ LTLFLKVWQPK     +G   +A               +   
Sbjct: 244 HIGPELPDITSALVSLVSLTLFLKVWQPKSASQRAGGAVKAGGGAAALARMGGGLASDAG 303

Query: 289 TFSNG-----------------QIFKAWSPFIILTAIVTLWSIKDVQL------ALSFAT 325
           +F NG                 Q  +AW+PF ILTAIVT+WS+   +       AL+   
Sbjct: 304 SFGNGAGDGAGNNRRASPYTVAQTVRAWAPFGILTAIVTVWSLPSFKALFVGNGALAGWV 363

Query: 326 ISIEVPYLHNLVIKTAPIVAKETPYAAIYKLNLLGAVGTAILIAAMISIVVLKMSISNAL 385
           +   VP L  LVIK APIVA+   Y A++KL+L+ AVGTAIL+ A+IS V+L+M    AL
Sbjct: 364 LKFHVPALDQLVIKAAPIVAQPKAYEAVFKLDLVSAVGTAILLTALISAVLLRMKPGAAL 423

Query: 386 TSFKDTLIELRFPILSIGLVLAFAFVANYSGLSSTLALVLAGTGVAFPFFSPFLGWLGVF 445
            +F +TL+ELR PILSIGLVL FAFVANYSG+SSTLAL+LAGTG AFPFFSPFLGWLGVF
Sbjct: 424 ATFGETLMELRRPILSIGLVLGFAFVANYSGMSSTLALLLAGTGAAFPFFSPFLGWLGVF 483

Query: 446 LTGSDTSSNALFGALQANTANQIGVTPELLVAANTTGGVTGKMISPQSIAVACAATGLAG 505
           LTGSDTSSNALF +LQ+ TA+QIGV+  LLVAANTTGGVTGKMISPQSIAVACAATGL G
Sbjct: 484 LTGSDTSSNALFCSLQSTTAHQIGVSDTLLVAANTTGGVTGKMISPQSIAVACAATGLVG 543

Query: 506 KESDLFRFTLKHSLFFCTFIGVLTVLQAYIV 536
           KES+LFRFT+KHSL F   +G++T+LQAY++
Sbjct: 544 KESELFRFTVKHSLLFAMIVGIITMLQAYVL 574


Lambda     K      H
   0.327    0.140    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1035
Number of extensions: 32
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 545
Length of database: 580
Length adjustment: 36
Effective length of query: 509
Effective length of database: 544
Effective search space:   276896
Effective search space used:   276896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory