Align 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 (characterized)
to candidate RR42_RS14430 RR42_RS14430 type II citrate synthase
Query= SwissProt::O34002 (379 letters) >FitnessBrowser__Cup4G11:RR42_RS14430 Length = 433 Score = 187 bits (474), Expect = 6e-52 Identities = 128/396 (32%), Positives = 184/396 (46%), Gaps = 34/396 (8%) Query: 5 TIHKGLAGVTADVTAISKVNSDTNSLLYRGYPVQELAAKCSFEQVAYLLWNSELPNDSEL 64 T G + + I+ ++ D LLYRGYP+++LA KC + YLL ELPN + Sbjct: 46 TYDPGFMSTASCNSKITYIDGDKGELLYRGYPIEQLATKCDHLETCYLLLKGELPNAKQK 105 Query: 65 KAFVNFERSHRKLDENVKGAIDLLSTACHPMDVARTAVSVLGANHARAQD-SSPEANLEK 123 + FV +H + E ++ + HPM V V + A + A D P Sbjct: 106 EEFVGAVMNHTMVHEQMQFFLRGFRRDAHPMAVLTGLVGAMSAFYHDAMDIDDPHQREIS 165 Query: 124 AMSLLATFPSVVAYDQRRRRGEELIEPREDLDYSANFLWMTFGEEAAPEVV-----EAFN 178 A+ L+A P++VA + G+ I P+ DL YS NF+ M F AP V A + Sbjct: 166 AIRLIAKMPTLVAMAYKYNIGQPYIYPQNDLSYSGNFMQMMFSTPCAPYKVNPVLERALD 225 Query: 179 VSMILYAEHSFNASTFTARVITSTLADLHSAVTGAIGALKGPLHGGANEAVMHTFEEIGI 238 IL+A+H NAST T R+ S+ + +A+ + L GP HGGANEA + EEIG Sbjct: 226 RIFILHADHEQNASTSTVRLAGSSGTNPFAAIAAGVACLWGPAHGGANEAALKMLEEIG- 284 Query: 239 RKDESLDEAATRSKAWMVDALAQKKKVMGFGHRVYKNGDSRVPTMKSALDAMIKHYDRPE 298 S+D K V ++MGFGHRVYKN D R M+ Y+ Sbjct: 285 ----SVDNITEFIK--QVKDKNSGVRLMGFGHRVYKNYDPRAKLMRETC------YEVLN 332 Query: 299 MLGLYN-------------GLEAAMEEAKQIKPNLDYPAGPTYNLMGFDTEMFTPLFIAA 345 LGL+N LE ++++ PN+D+ +G +G T +FT +F A Sbjct: 333 ELGLHNDPLFKLAMELEKIALEDEYFVSRKLYPNVDFYSGIVQRALGIPTSLFTCIFALA 392 Query: 346 RITGWTAHIMEQVAD--NALIRPLSEYNGPEQRQVP 379 R GW + E + D + RP +NG R VP Sbjct: 393 RTPGWISQWEEMITDPEYKIGRPRQLFNGAASRNVP 428 Lambda K H 0.316 0.130 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 379 Length of database: 433 Length adjustment: 31 Effective length of query: 348 Effective length of database: 402 Effective search space: 139896 Effective search space used: 139896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory