Align Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase (EC 2.6.1.19) (characterized)
to candidate RR42_RS01575 RR42_RS01575 omega amino acid--pyruvate aminotransferase
Query= reanno::WCS417:GFF5299 (454 letters) >FitnessBrowser__Cup4G11:RR42_RS01575 Length = 443 Score = 259 bits (661), Expect = 2e-73 Identities = 154/431 (35%), Positives = 236/431 (54%), Gaps = 15/431 (3%) Query: 22 PFSDFKQLKEKGPRIITKAHGVYLWDSEGNKILDGMAGLWCVAIGYGRDELADAAAKQMK 81 PF+ +Q K PR++ A G+Y +G +ILDG AGLWCVA G+ R E+ADA A+Q++ Sbjct: 17 PFTANRQYKA-APRLLDSASGMYYTSHDGRQILDGCAGLWCVAAGHCRQEIADAVARQVQ 75 Query: 82 ELPYYNLFFQTAHPPVLELAKAISDIAPAGMNHVFFTGSGSEGNDTMLRMVRHYWAIKGQ 141 L Y F Q +HP E A ++ I PAG++ +FFT SGSE DT L++ Y +G+ Sbjct: 76 TLDYAPPF-QMSHPLTFEAATKVAAIMPAGLDRIFFTNSGSESVDTALKIALAYHRARGE 134 Query: 142 PNKKTIISRKNGYHGSTVAGASLGGMTYMHEQGDLPI-PGITHIAQPYWFGEGG-DMSPE 199 + +I R+ GYHG G ++GG+ + + PG H+ E Sbjct: 135 GQRTRVIGRERGYHGVGFGGMAVGGIGPNRKAFSANLMPGTDHLPATLNIAEAAYSKGQP 194 Query: 200 EFGVWAANQLEEKILELGVDNVGAFIAEPIQGAGGVIVPPATYWPRIKEILAKYDILFIA 259 +G A+ LE + NV A I EP+ G+ GV+VPP Y +++EI +K+ IL I Sbjct: 195 TWGAHLADDLERILALHDPSNVAAVIVEPLAGSAGVLVPPVGYLEKLREITSKHGILLIF 254 Query: 260 DEVICGFGRTGEWFGSDFYDLKPHMMTIAKGLTSGYIPMGGLIVRDEVVE-VLNEGG--- 315 DEVI FGR G ++ +++ P ++T+AK + + +PMG + VR EV + V+N Sbjct: 255 DEVITAFGRLGAATAAERFNVTPDLITMAKAINNAAVPMGAVAVRREVHDTVVNAAAPGA 314 Query: 316 -DFNHGFTYSGHPVAAAVALENIRIMRDEKIVNRVHDETAPYLQKRLRELADHPLVGEVR 374 +F HG+TYSGHP+A A A+ + I ++E + R E AP + + + P V ++R Sbjct: 315 IEFLHGYTYSGHPLAMAAAIATLDIYKNENLFGRA-AELAPKFEAAVHAVRGAPHVKDIR 373 Query: 375 GVGMLGAIELVQDKATRKRYEGKGVGMICRTFCFENGLIMRAVGDTMIISPPLVISKAEI 434 +GM+ IEL R G G C E G+++R GD + SPPL+I++A+I Sbjct: 374 NLGMVAGIEL----EPRPGQPG-ARGYEAFLKCLERGVLVRYTGDILAFSPPLIITEAQI 428 Query: 435 DELVTKARQCL 445 +E+ + L Sbjct: 429 EEMFDTVKTVL 439 Lambda K H 0.320 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 454 Length of database: 443 Length adjustment: 33 Effective length of query: 421 Effective length of database: 410 Effective search space: 172610 Effective search space used: 172610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory