Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate RR42_RS37305 RR42_RS37305 sulfate ABC transporter ATP-binding protein
Query= TCDB::P31134 (377 letters) >FitnessBrowser__Cup4G11:RR42_RS37305 Length = 366 Score = 241 bits (616), Expect = 2e-68 Identities = 142/326 (43%), Positives = 198/326 (60%), Gaps = 13/326 (3%) Query: 31 GQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLDGVDLSQVPPYL 90 G A+D VSL++ +GE+ LLG SGCGK+TLLR++AG E+ G+I G +L+ +PP Sbjct: 27 GFQALDGVSLSVAQGELLCLLGPSGCGKTTLLRIIAGLEREDTGRIHAGGRELTGLPPQA 86 Query: 91 RPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLGLVHMQEFAKRKPHQL 150 R ++FQSYALFP+++V +N+A+GL+ + +A +RV EML LV + ++ P QL Sbjct: 87 RDYGILFQSYALFPNLSVARNVAYGLQGRGMGRAHREARVAEMLSLVGLAGSERKFPGQL 146 Query: 151 SGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVGVTCVMVTHDQ 210 SGGQ+QRVALAR+LA P LLLLDEPM ALD ++R+ ++LE+ + R+ VT VMVTHDQ Sbjct: 147 SGGQQQRVALARALAPAPSLLLLDEPMSALDARVREHLRLELRQLQRRLNVTTVMVTHDQ 206 Query: 211 EEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNVFEGVLKERQEDGLVL 270 +EAM MA RIA+M G+ Q+G P EIYE P + + AEFIG N +G L R Sbjct: 207 DEAMAMADRIAVMEGGRIAQVGTPGEIYERPASAFVAEFIGQANWLDGRLSGRD-----T 261 Query: 271 DSPGLVHPLKVDADASVVDNVPVHVALRPEKIMLCEEPPANGCNFAVGEVIHIAYLGDLS 330 S G + A AS V + + RPE I L P N + ++ YLG S Sbjct: 262 FSVGELDLAVSPARASEVADGAARLCCRPEAIRL--HPVEGEPNRLLARIVDQTYLG--S 317 Query: 331 VYHVRLKS----GQMISAQLQNAHRH 352 Y + L++ G + A + RH Sbjct: 318 RYRLMLEADRLPGHTLFADVLREERH 343 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 356 Number of extensions: 19 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 366 Length adjustment: 30 Effective length of query: 347 Effective length of database: 336 Effective search space: 116592 Effective search space used: 116592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory