GapMind for catabolism of small carbon sources

 

Aligments for a candidate for actP in Cupriavidus basilensis 4G11

Align actP-like component of D-alanine uptake system (characterized)
to candidate RR42_RS13875 RR42_RS13875 sodium:solute symporter

Query= reanno::psRCH2:GFF346
         (589 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS13875 RR42_RS13875 sodium:solute
           symporter
          Length = 683

 Score =  195 bits (495), Expect = 6e-54
 Identities = 130/341 (38%), Positives = 179/341 (52%), Gaps = 41/341 (12%)

Query: 244 KLNMFLFTLSLMIGTAGLPHVIIRFFTVPKVADARWSAGWTLVFIALLYLTAPAVASMAR 303
           +LN  L    LM+GTA LPH++ R +T P V ++R S  W + FIALLY++APA+A++ +
Sbjct: 376 RLNFVLLVFCLMLGTASLPHILTRLYTTPSVKESRNSVAWAVFFIALLYVSAPALAALVK 435

Query: 304 L----NLVNTIYPEGPQAEAIRYEDRPEWVQTWERTG--LIKWEDKNADGRVQMYNDANA 357
                +LV T Y E PQ           WV  W +    +    D N DG VQ       
Sbjct: 436 YEFFQHLVGTPYAELPQ-----------WVVQWRKVDPPVFGIRDVNGDGIVQ------- 477

Query: 358 KFTPTATERGWNGNELTVNNDIIVLANPEIANLPGWVIGLIAAGAIAAALSTAAGLLLAI 417
                     W   E+ +  D+IVLA PEIA LP  + GL+AAGA+AAALSTA GLLL I
Sbjct: 478 ----------WA--EILIQPDMIVLAAPEIAGLPYVISGLVAAGALAAALSTADGLLLTI 525

Query: 418 SSAISHDLIKTLINPKISEKNEMLAARLSMTAAILLATWLGLNPPGFAAQVVALAFGLAA 477
           ++A+SHD+   + +   S +  +  A++ +    L A+++    PG    +V  AF LAA
Sbjct: 526 ANALSHDVFYHMGDRTASHQRRVTTAKIVLLGVALFASYVTSLRPGNILFLVGAAFSLAA 585

Query: 478 ASLFPALMMGIFSKRVNSKGAVAGMLVGVISTAVYIFLYLGWFFIPGTASIPNTPDQWWM 537
           +S FP L++ IF +R  + GAVAGM+ G+     YIF+    FF   T    N     W 
Sbjct: 586 SSFFPVLVLAIFWRRTTAAGAVAGMVAGLGVAVYYIFVNYP-FFTRMTGIFGNR----WF 640

Query: 538 GISPQAFGAVGAMLNFAVAYAVSMATEAPPQEIQDLVESVR 578
           G+ P A GA G    FAVA  VS+ T      I  LV  +R
Sbjct: 641 GVDPIASGAFGVPAGFAVAILVSLLTPRNAPVIDRLVTYLR 681



 Score =  171 bits (434), Expect = 7e-47
 Identities = 93/229 (40%), Positives = 133/229 (58%), Gaps = 16/229 (6%)

Query: 5   WINMLFVGASFLLYIGIAVWARAGSTKEFYVAGGGVHPVTNGMATAADWMSAASFISMAG 64
           W+  +F+  +  +Y  I +  R     E+YVAG  V  + NGMA AADWMSAASFI +AG
Sbjct: 42  WLGYVFLFVTIAIYACIGLICRTSDLNEYYVAGRRVPALFNGMAIAADWMSAASFIGLAG 101

Query: 65  LIASGGYATSVYLMGWTGGYVLLAMLLAPYLRKFGKFTVPDFIGDRFYSRG-------AR 117
           ++ + GY    Y+MGWTGGY L+A LLAPYLRK+G +T+PDF+  R Y  G        R
Sbjct: 102 ILFASGYEGLAYVMGWTGGYCLVAFLLAPYLRKYGGYTIPDFLAAR-YGNGKPGGNMPVR 160

Query: 118 LTAVVCLILISVTYVIGQMAGAGVAFSRFLEVSNSAGIWIAAAIVFAYAVFGGMKGITYT 177
             AV+   L S  Y++ Q+ G G+  +RF+ V  + G++   A +   +  GGM+ +T+T
Sbjct: 161 AIAVMAASLCSFVYLVAQIQGVGLIVTRFIGVEFAVGVFFGLAGILVCSFLGGMRAVTWT 220

Query: 178 QVAQYIVLIIAYTIPAVFIAMQLTGNPIPMFGMFGTHVDSGVPLLDKLD 226
           QVAQYI+LI A+ +    IA +     +P    +GT       LL +LD
Sbjct: 221 QVAQYIMLIAAFLVTVSMIAWKHHHEALPQLS-YGT-------LLQQLD 261


Lambda     K      H
   0.324    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1030
Number of extensions: 53
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 589
Length of database: 683
Length adjustment: 38
Effective length of query: 551
Effective length of database: 645
Effective search space:   355395
Effective search space used:   355395
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory