Align 2-dehydro-3-deoxy-L-rhamnonate dehydrogenase (NAD(+)); 2-keto-3-deoxy-L-rhamnonate dehydrogenase; KDRDH; L-KDR dehydrogenase; EC 1.1.1.401 (characterized)
to candidate RR42_RS09405 RR42_RS09405 butanediol dehydrogenase
Query= SwissProt::P0DOW0 (331 letters) >FitnessBrowser__Cup4G11:RR42_RS09405 Length = 357 Score = 145 bits (366), Expect = 1e-39 Identities = 102/340 (30%), Positives = 159/340 (46%), Gaps = 29/340 (8%) Query: 1 MKTLTWTAKETMSILSAPAP-VPEPGWIALRVAGVGICGSELSGYLGHNEL--------- 50 MK W + + + P P GW+ +RV GICGS+L Y+ Sbjct: 1 MKAAVWRGRHDVRVEEVRVPDKPAEGWVKIRVHWCGICGSDLHEYVAGPVFIPVDHPHPL 60 Query: 51 --RKPPLVMGHEFSGVVEEVGHGVTNVKIGDLVTANPLVTCGRCIHCLRGERQRCESRRI 108 K ++GHEFSG + E+G GVT K+G+ VTA+ CG+C +C G CES Sbjct: 61 TGLKGQCILGHEFSGEIAELGAGVTGFKVGERVTADACQHCGKCYYCTHGLYNICESLAF 120 Query: 109 IGIDFPGAYAERVLVPSNQCYAVKDAID---GALVEPLACAVRAVGLARIKVGDTAVVIG 165 G+ GA+AE V VP+ Y + + GAL+EPLA + AV A VG T VV+G Sbjct: 121 TGLMNNGAFAEYVNVPAELLYKLPENFPTEAGALIEPLAVGLHAVKKAGNIVGQTVVVVG 180 Query: 166 AGIIGLMTVRLLGLSGAKRIAVVDPNDERLKISQLWGAT-----EMAPNLGALLTDNHPQ 220 AG IGL T+ +GA RI ++ + R K + GA + + + Sbjct: 181 AGTIGLCTIMCAKAAGAGRIIALEMSSARKKKALEVGANVVIDPKECDAIAQVKALTGGY 240 Query: 221 SFDCVIDAVGLSTTRRDSLNALIRGGRAVWIGLHEALTHLDGNQIVRDELEVRGSFCYTD 280 D + +G T + +++ + + G+ V +G+ E + + +IV E E+ GS Y + Sbjct: 241 GADVSFECIGNKATAKLAIDVIRKAGKCVMVGIFEEPSAFNFFEIVSTEKEIIGSLAY-N 299 Query: 281 DEFIRAVSLINSQKFLPVDRQWLDVRSLEEGPAAFKELVN 320 EF + I + +DV+ L G + ++V+ Sbjct: 300 GEFADVIRFIADGR--------IDVQPLITGRISLADIVS 331 Lambda K H 0.322 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 357 Length adjustment: 29 Effective length of query: 302 Effective length of database: 328 Effective search space: 99056 Effective search space used: 99056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory