Align RhaP, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized)
to candidate RR42_RS03365 RR42_RS03365 ribose ABC transporter permease
Query= TCDB::Q7BSH3 (333 letters) >FitnessBrowser__Cup4G11:RR42_RS03365 Length = 333 Score = 173 bits (439), Expect = 5e-48 Identities = 109/312 (34%), Positives = 172/312 (55%), Gaps = 5/312 (1%) Query: 6 RKRETLLFLIIVVMIVVFSTRAADFATPGNLAGIFNDTSILIILALAQMTVILTKSIDLS 65 R R + ++V++ + FS +FA NL+ I SI ++LA VILT IDLS Sbjct: 25 RLRALGMLPVLVLLCIGFSVLTENFAGWQNLSIIAQQASINMVLAAGMTFVILTGGIDLS 84 Query: 66 VAANLAFTGMAIAMMNAAHPDLPLVVLILMAVVIGACLGAINGFLVWALEIPPIVVTLGT 125 V + L+ + + +AM+ + P L ++ + A++ G G +NG LV +++PP +VTLGT Sbjct: 85 VGSILSISAV-VAMLVSLMPQLGMLS-VPAALLCGLLFGIVNGALVAFMKLPPFIVTLGT 142 Query: 126 LTIYRGMAFVLSGGAWVNAHQMTPIFLSVPRTPVLGLPVLSWVGIIIVILMYVLLRYTQF 185 LT RG+A ++ + + + F + VLG+P L + +V + + +LR T Sbjct: 143 LTAVRGLARLVGNDSTIYNPDIG--FAFIGNGEVLGVPWLVIIAFAVVAVSWFVLRRTVL 200 Query: 186 GRSAYATGGNPTAAVYAGIDTGWTKFLAFVLSGALAGLASYLWVSR-YAVAYVDIANGFE 244 G YA GGN AA +GI + +SG LAGL + +R YA + + +E Sbjct: 201 GLQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAANGLQLGQSYE 260 Query: 245 LDSVAACVIGGISIAGGVGSVAGTVLGALFLGVIKNALPVIGISPFTQMAISGTVIILAV 304 LD++AA ++GG S GG GS+ GT++GAL + V+ N L ++G+S Q I G VII AV Sbjct: 261 LDAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYIIKGLVIIGAV 320 Query: 305 AFNARRERNRGR 316 A ++ R + R Sbjct: 321 ALDSYRRKGSAR 332 Lambda K H 0.328 0.141 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 294 Number of extensions: 17 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 333 Length adjustment: 28 Effective length of query: 305 Effective length of database: 305 Effective search space: 93025 Effective search space used: 93025 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory