Align Fructose import permease protein FrcC (characterized)
to candidate RR42_RS03365 RR42_RS03365 ribose ABC transporter permease
Query= SwissProt::Q9F9B1 (360 letters) >FitnessBrowser__Cup4G11:RR42_RS03365 Length = 333 Score = 187 bits (474), Expect = 4e-52 Identities = 126/310 (40%), Positives = 174/310 (56%), Gaps = 11/310 (3%) Query: 52 LIVLVLSLIAFGVILGGKFFSAFTMTLILQQVAIVGIVGAAQTLVILTAGIDLSVGAIMV 111 L VLVL I F V L F +++I QQ +I ++ A T VILT GIDLSVG+I+ Sbjct: 32 LPVLVLLCIGFSV-LTENFAGWQNLSIIAQQASINMVLAAGMTFVILTGGIDLSVGSILS 90 Query: 112 LSSVIMGQFTFRYGFPPALSVICGLGVGALCGYINGTLVARMKLPPFIVTLGMWQIVLAS 171 +S+V+ + LSV L G L G +NG LVA MKLPPFIVTLG V Sbjct: 91 ISAVVAMLVSLMPQLG-MLSVPAALLCGLLFGIVNGALVAFMKLPPFIVTLGTLTAVRGL 149 Query: 172 NFLYSANETIRAQDISANASILQFFGQNFRIGNAVFTYGVVVMVLLVCLLWYVLNRTAWG 231 L + TI DI F G +G + V++ +V + W+VL RT G Sbjct: 150 ARLVGNDSTIYNPDIG-----FAFIGNGEVLG---VPWLVIIAFAVVAVSWFVLRRTVLG 201 Query: 232 RYVYAVGDDPEAAKLAGVNVTRMLISIYTLSGLICALAGWALIGRIGSVSPTA-GQFANI 290 +YAVG + EAA+L+G+ V +L+ +Y +SGL+ L G R+ + + GQ + Sbjct: 202 LQIYAVGGNAEAARLSGIKVWVVLLFVYAVSGLLAGLGGVMSSARLYAANGLQLGQSYEL 261 Query: 291 ESITAVVIGGISLFGGRGSIMGMLFGALIVGVFSLGLRLMGTDPQWTYLLIGLLIIIAVA 350 ++I AV++GG S GG GSI+G L GALI+ V S GL L+G W Y++ GL+II AVA Sbjct: 262 DAIAAVILGGTSFVGGTGSIVGTLVGALIIAVLSNGLVLLGVSDIWQYIIKGLVIIGAVA 321 Query: 351 IDQWIRKVAA 360 +D + RK +A Sbjct: 322 LDSYRRKGSA 331 Lambda K H 0.327 0.141 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 390 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 333 Length adjustment: 29 Effective length of query: 331 Effective length of database: 304 Effective search space: 100624 Effective search space used: 100624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory