Align ABC-type transporter, integral membrane subunit, component of D-ribose porter (Nanavati et al., 2006). Induced by ribose (characterized)
to candidate RR42_RS32895 RR42_RS32895 ABC transporter permease
Query= TCDB::Q9X050 (331 letters) >FitnessBrowser__Cup4G11:RR42_RS32895 Length = 318 Score = 218 bits (556), Expect = 1e-61 Identities = 119/303 (39%), Positives = 183/303 (60%), Gaps = 11/303 (3%) Query: 21 SIFILLGLIVLFSFLSNRFLTLENFWIILRQTAVNLCIAVGMTFVILTGGIDLSVGSILG 80 S+++LL L + FS FL++EN I Q+ + L IA+ MT +I+T G+DLS+G++L Sbjct: 21 SVWVLLLLSLGFSVTGPGFLSVENLLNIGAQSTILLLIALPMTLIIMTEGLDLSMGAVLT 80 Query: 81 FSGAVTAKLLKYGLILSAFGVVLKFNPLGASIIGVLAGFAIGLFNGFIITRFNIPPFVAT 140 G V A ++ V + PL +L G A GL NG +++ IPPFVAT Sbjct: 81 LCGVVLAMVM----------VATESLPLALGA-ALLTGLAFGLLNGALVSWLEIPPFVAT 129 Query: 141 LGTMTAVRGFIMLLTKGHPITRLGDSFDFIGSGWFLGIPMPVWIAAIATGVGIFILRKTQ 200 LGT+ +G ++ T G +T +G++ I +G LG+P+P+WIAA+ G+ ++L T+ Sbjct: 130 LGTLGVAQGLALVATDGQSVTGIGEAIPLIYAGQLLGVPLPIWIAAVFYGLFHWLLYHTR 189 Query: 201 FGRYVYAVGGNEKAAVLSGVNSKLTKLWVYAISGILSAVAGLIVTARLDSAQPNAGLMYE 260 FG YV+A+GGN +A SGV + + VYA+ G+++ VA L++TAR+++ P A + E Sbjct: 190 FGAYVFALGGNREALKFSGVRINVYLIAVYALGGLMAGVAALLLTARMNAGHPTAAIGLE 249 Query: 261 LDAIAATVIGGASLSGGKGTLIGTVVGALIIGVLNDGLVLVGVSPFWQQVAKGFIIIAAV 320 DAIAA +GG + G G L GTV+G L +GVL +GL LVGV Q A G +++ + Sbjct: 250 FDAIAAVAVGGTTFDRGNGWLPGTVLGVLAVGVLRNGLNLVGVPSSVQVAAIGLLVLVVL 309 Query: 321 IAE 323 + E Sbjct: 310 LIE 312 Lambda K H 0.327 0.144 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 381 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 318 Length adjustment: 28 Effective length of query: 303 Effective length of database: 290 Effective search space: 87870 Effective search space used: 87870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory