Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate RR42_RS14415 RR42_RS14415 leucine/isoleucine/valine transporter permease subunit
Query= uniprot:A0A165KER0 (358 letters) >FitnessBrowser__Cup4G11:RR42_RS14415 Length = 424 Score = 265 bits (676), Expect = 2e-75 Identities = 163/364 (44%), Positives = 217/364 (59%), Gaps = 49/364 (13%) Query: 5 KTNWIIGAVALLVLPLILQSFGNAWVRIADLALLYVLLALGLNIVVGYAGLLDLGYVAFY 64 K W++ AV L V P V +A LAL+YV+L LGLNIVVGYAGLLDLGYV FY Sbjct: 98 KVIWLLLAVGL-VFPFFSS---RGAVDVATLALIYVILGLGLNIVVGYAGLLDLGYVGFY 153 Query: 65 AVGAYLFALMASPHLADNFAAFAAMFPNGLHTSLWIVIPVAALLAAFFGAMLGAPTLKLR 124 AVG Y +AL+ F F W +P+AA ++A FG +LG P L+LR Sbjct: 154 AVGGYTYALLNQ--------YFGLTF--------WECLPIAAGMSALFGFVLGFPVLRLR 197 Query: 125 GDYLAIVTLGFGEIIRIFLNNLDHPVNLTNGPKGLGQIDSVKVFGLDLGKRL-------- 176 GDYLAIVTLGFGEIIR+ LNNL +LT GP G+ I VFG+++ + Sbjct: 198 GDYLAIVTLGFGEIIRLLLNNL---TSLTGGPDGVSGIPKPTVFGIEMARSASVEGVKTF 254 Query: 177 -EVFGFDINS---VTLYYYLFLVLVVVSVIICYRLQDSRIGRAWMAIREDEIAAKAMGIN 232 E+ G+D + V Y L L+LV ++ + RL +GRAW A+REDEIA +++G+N Sbjct: 255 HELLGWDYSGEHMVIFLYLLALLLVGFTLFVTSRLIRMPMGRAWEALREDEIACRSLGLN 314 Query: 233 TRNMKLLAFGMGASFGGVSGAMFGAFQGFVSPESFSLMESVMIVAMVVLGGIGHIPGVIL 292 +KL AF +GA+F G+ GA F A QG V+PESF+ +ES +I+A+VVLGG+G GVIL Sbjct: 315 PTRIKLSAFTLGAAFAGLGGAFFAARQGLVNPESFTFIESALILAVVVLGGMGSQLGVIL 374 Query: 293 GAVLLSALPEVLRYVAGPLQAMTDGRLDSAILRQLLIALAMIIIMLLRPRGLWPSPEHGK 352 A+LL+ALPE+ R A R L+ L M+++M+ RP+GL P+ Sbjct: 375 AAILLTALPEMAR--------------GFAEYRMLIFGLVMVLMMMWRPQGLLPASRPHV 420 Query: 353 SLTQ 356 L Q Sbjct: 421 ELPQ 424 Lambda K H 0.328 0.144 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 424 Length adjustment: 30 Effective length of query: 328 Effective length of database: 394 Effective search space: 129232 Effective search space used: 129232 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory