Align L-iditol 2-dehydrogenase (EC 1.1.1.14) (characterized)
to candidate RR42_RS21790 RR42_RS21790 short-chain dehydrogenase
Query= BRENDA::Q1J2J0 (255 letters) >FitnessBrowser__Cup4G11:RR42_RS21790 Length = 252 Score = 186 bits (472), Expect = 4e-52 Identities = 110/248 (44%), Positives = 147/248 (59%), Gaps = 14/248 (5%) Query: 18 GRHALVTGGAQGIGFEIARGLAQAGARVTIADLNPDVGEGAARELDGTFERLNV------ 71 G+ L TGGA GIG +A G A+ GAR+ + DL+ A EL+ + + V Sbjct: 3 GKVVLNTGGASGIGRAMAHGFARHGARLMLLDLDAQGLASAKAELEAAYPEVQVEIVKAS 62 Query: 72 -TDADAV----ADLARRLPDVDVLVNNAGIVRNAPAEDTPDDDWRAVLSVNLDGVFWCCR 126 TD DAV A R +D+L+NNAGI N P+ + DDWR + ++L GVF+C + Sbjct: 63 ITDPDAVEQACAATEARFGRIDILLNNAGISMNKPSLELTPDDWRRAIDIDLSGVFFCTQ 122 Query: 127 EFGRTMLARGRGAIVSTASMSGLISNHPQPQAAYNASKAAVIHLTRSLAGEWASRGVRVN 186 R M+ +G G+I+STASM GL S+ + AY A+KA V+ LT+SLA EWA +RVN Sbjct: 123 AAARRMVRQGGGSILSTASMWGLASS--ARRLAYCAAKAGVVSLTKSLAAEWAEYNIRVN 180 Query: 187 AVAPGYTATPLTRRGLETPEW-RETWLKETPLGRLAEPREIAPAVLYLASDAASFVTGHT 245 AV PGYT+T L L + E L TPL R P E+A L+LASD+A+F+TGH Sbjct: 181 AVCPGYTSTALMETLLASKAIDGEALLARTPLRRFGAPEEMAEVALFLASDSAAFITGHA 240 Query: 246 LVVDGGYT 253 LV DGG+T Sbjct: 241 LVSDGGWT 248 Lambda K H 0.319 0.134 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 208 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 252 Length adjustment: 24 Effective length of query: 231 Effective length of database: 228 Effective search space: 52668 Effective search space used: 52668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory