Align Sorbitol dehydrogenase; SDH; Polyol dehydrogenase; EC 1.1.1.- (characterized)
to candidate RR42_RS35005 RR42_RS35005 L-idonate 5-dehydrogenase
Query= SwissProt::P0DMQ6 (355 letters) >FitnessBrowser__Cup4G11:RR42_RS35005 Length = 342 Score = 194 bits (494), Expect = 2e-54 Identities = 111/332 (33%), Positives = 179/332 (53%), Gaps = 13/332 (3%) Query: 7 NLAVVVHRAGDLRLENRPIPEPGPNEVLLRMHSVGICGSDVHYWQHGRIGDFVVKDPMVL 66 +L +H + DLR PGP EV +R+ + GICGSD+HY+ HG++G FV+++P+ Sbjct: 2 SLVCHIHASEDLRFTQVEPAAPGPFEVEVRLGAAGICGSDLHYYFHGKVGAFVIREPLTP 61 Query: 67 GHEASGTVIKVGAGVTHLKPGDRVAIEPGVPRETDEFCKTGRYNLSPTIFFCAT----PP 122 GHEA+G V +VG+ VT + PG++VAI P ++C+ GR NL ++ F + P Sbjct: 62 GHEAAGIVSRVGSAVTRVAPGNKVAINPSHACGQCDYCRAGRDNLCRSMRFLGSASIYPH 121 Query: 123 DDGNLCRYYKHSASYCYKLPDSVTFEEGALIEPLSVGIHACKRAGVTLGSRVFVSGSGPI 182 G ++ + ++ E A EPLSV +H RAG LG V V+G G I Sbjct: 122 VQGMFREHFLMHERQLTPVDSDISLGELAFAEPLSVALHGVNRAGELLGKTVLVTGGGTI 181 Query: 183 GLVNVIIAKMMGAAAVVVTDLSASRLQTAKELGADFTIQIKNETPQEVAAKVESLLGCMP 242 G + V+ A++ GAA ++ D++ L+ A +GAD I+ E P+ L + Sbjct: 182 GSLAVMAARLAGAAHIIACDIADRPLEVALRVGADQVIRTDREPPR--------ALQDLA 233 Query: 243 EITVECTGVQACIQASIYATRSGGTLVLVGLGP-EMVTVPIVNAAVREVDIRGIFRYCNT 301 ++ +E G A + + A R G +V +G P E + P N RE++ G FR+ Sbjct: 234 DVCLEAAGSGAALDTCLLAARRGARIVQIGTLPAEGLHFPANNIMARELEYVGAFRFGRE 293 Query: 302 WPVAISLLASKRINIKPLVTHRFPLEKALEAF 333 + A+ L R++++PL++ + PL +A+EAF Sbjct: 294 FDWAVRYLTQGRLDVRPLLSAQLPLAQAVEAF 325 Lambda K H 0.320 0.137 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 313 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 342 Length adjustment: 29 Effective length of query: 326 Effective length of database: 313 Effective search space: 102038 Effective search space used: 102038 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory