Align Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140) (characterized)
to candidate RR42_RS31820 RR42_RS31820 short-chain dehydrogenase
Query= reanno::Koxy:BWI76_RS01745 (267 letters) >FitnessBrowser__Cup4G11:RR42_RS31820 Length = 261 Score = 116 bits (291), Expect = 4e-31 Identities = 87/270 (32%), Positives = 128/270 (47%), Gaps = 29/270 (10%) Query: 6 NLKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQS-------SGNYNFWPT 58 +L+ K+ +TG A GIG L A GA V ++D+ D + G FW Sbjct: 9 DLRGKVAAITGAARGIGAETARVLAAAGAKVAVLDLLEADGQAAVRRIEAEGGQAAFWKL 68 Query: 59 DISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAAFEKMVNI 118 D+SS +EV K I RFGR+D L+NNAG++ AP+ +EL A +++++++ Sbjct: 69 DVSSEAEVGKVFGEIAARFGRLDILINNAGID------GVNAPT--HELALAQWQRVMDV 120 Query: 119 NQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFTRSWSKEL 178 N G FL ++ + + G IVNVSS G+ G Y A+KAA+ ++ + Sbjct: 121 NVTGTFLCTKHAIAHLERAGGGSIVNVSSMYGIVGGPDVPPYHASKAAVRMMAKTDAMLY 180 Query: 179 GKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREG---YSKNSIPLGRSGRL 235 IR V PG +RTP EE EG Y P+GR G Sbjct: 181 AGKNIRANSVHPGY-----IRTPMLEEV------AHASGQGEGLFAYLGAQAPMGRLGEP 229 Query: 236 TEVADFVCYLLSERASYMTGVTTNIAGGKT 265 ++A + YL+S+ A Y+TG I GG T Sbjct: 230 RDIAAGILYLVSDAARYVTGAELVIDGGYT 259 Lambda K H 0.315 0.132 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 261 Length adjustment: 25 Effective length of query: 242 Effective length of database: 236 Effective search space: 57112 Effective search space used: 57112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory