Align Sugar hosphotransferase system IIA component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized)
to candidate RR42_RS02075 RR42_RS02075 PTS sugar transporter subunit IIA
Query= TCDB::Q5V5X4 (158 letters) >FitnessBrowser__Cup4G11:RR42_RS02075 Length = 151 Score = 78.6 bits (192), Expect = 4e-20 Identities = 45/146 (30%), Positives = 74/146 (50%), Gaps = 1/146 (0%) Query: 10 IEELIPANHISLSEPPAEKEACIESLLDLLVDSGRVEDRDRALEALLERESETTTGVGMG 69 + +L+P +I+L K+ E LL ++ R + L RES +TG+G G Sbjct: 4 LAKLLPPGNINLDVSVTSKKRVFEQA-GLLFENNHGVARATVTDNLFARESLGSTGLGAG 62 Query: 70 IGIPHAKTDAVSRPSLAFARSQEGVDFGSMDGEPATLVFMILVPEAGGEEHLNILSSLSR 129 + IPH + + +P AF R E + F S DG+P L+ +LVPE ++HL ILS +++ Sbjct: 63 VAIPHGRIKGLKQPLAAFMRLAEPIPFESPDGKPVALLIFLLVPEQATQQHLEILSEIAQ 122 Query: 130 ALMHDDVRDRLHAAADEATVQDVLRE 155 L ++R+ L V +L + Sbjct: 123 LLSDREMREGLATLPTPDDVHQLLTQ 148 Lambda K H 0.314 0.131 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 54 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 158 Length of database: 151 Length adjustment: 17 Effective length of query: 141 Effective length of database: 134 Effective search space: 18894 Effective search space used: 18894 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory