Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate RR42_RS37305 RR42_RS37305 sulfate ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >FitnessBrowser__Cup4G11:RR42_RS37305 Length = 366 Score = 205 bits (522), Expect = 1e-57 Identities = 118/288 (40%), Positives = 174/288 (60%), Gaps = 13/288 (4%) Query: 4 IIVKNVSKVFK-KGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGEL 62 + V+ V K F G ALD V++++ GE +LGPSG GKTT +RIIAGL+ TG + Sbjct: 13 LAVEQVGKRFGGAGGFQALDGVSLSVAQGELLCLLGPSGCGKTTLLRIIAGLEREDTGRI 72 Query: 63 YFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVE 122 + R + +PP+ R G++FQ++AL+PNL+ N+A+ L M + RV Sbjct: 73 HAGGRELTG-----LPPQARDYGILFQSYALFPNLSVARNVAYGLQGRGMGRAHREARVA 127 Query: 123 EVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARAL 182 E+ ++ + FP +LSGGQQQRVALARAL PSLLLLDEP S LDAR+R+ R Sbjct: 128 EMLSLVGLAGSERKFPGQLSGGQQQRVALARALAPAPSLLLLDEPMSALDARVREHLRLE 187 Query: 183 VKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIG 242 ++++Q RL VT ++V+HD + A+ADR+ V+ G++ QVG P ++Y+ P S VA IG Sbjct: 188 LRQLQRRLNVTTVMVTHDQDEAMAMADRIAVMEGGRIAQVGTPGEIYERPASAFVAEFIG 247 Query: 243 EINELEGKVTNEGVV-IGSLRFPVS------VSSDRAIIGIRPEDVKL 283 + N L+G+++ +G L VS V+ A + RPE ++L Sbjct: 248 QANWLDGRLSGRDTFSVGELDLAVSPARASEVADGAARLCCRPEAIRL 295 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 366 Length adjustment: 29 Effective length of query: 324 Effective length of database: 337 Effective search space: 109188 Effective search space used: 109188 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory