Align High-affinity branched-chain amino acid transport system permease protein BraE, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate RR42_RS14415 RR42_RS14415 leucine/isoleucine/valine transporter permease subunit
Query= TCDB::P21628 (417 letters) >FitnessBrowser__Cup4G11:RR42_RS14415 Length = 424 Score = 494 bits (1273), Expect = e-144 Identities = 264/419 (63%), Positives = 323/419 (77%), Gaps = 21/419 (5%) Query: 3 QSLKRALFSALLVILVSYPILGLKLRTVGIKLEVLGADAQTLWTIAAAALAMFVWQLFRD 62 Q+LK A+ +A++ +++ P+LGL+L+ G K+ VL Q +W A A+F++QLF+ Sbjct: 19 QTLKNAIVAAVMTAILTIPVLGLQLKLDGYKV-VLEPHWQPVWL---AVGAVFLFQLFK- 73 Query: 63 RIPLKLGRGVGYKVNGSGLKNFLSLPST----QRWAVLALVVVAFVWPFFASRGAVDIAT 118 PL G KV SLP+ QR + L+ V V+PFF+SRGAVD+AT Sbjct: 74 --PLFQRATAGIKVP--------SLPALGATQQRKVIWLLLAVGLVFPFFSSRGAVDVAT 123 Query: 119 LILIYVMLGIGLNIVVGLAGLLDLGYVGFYAVGAYTYALLAEYAGFGFWTALPIAGMMAA 178 L LIYV+LG+GLNIVVG AGLLDLGYVGFYAVG YTYALL +Y G FW LPIA M+A Sbjct: 124 LALIYVILGLGLNIVVGYAGLLDLGYVGFYAVGGYTYALLNQYFGLTFWECLPIAAGMSA 183 Query: 179 LFGFLLGFPVLRLRGDYLAIVTLGFGEIIRILLRNMTEITGGPNGIGSIPKPTLFGLTFE 238 LFGF+LGFPVLRLRGDYLAIVTLGFGEIIR+LL N+T +TGGP+G+ IPKPT+FG+ Sbjct: 184 LFGFVLGFPVLRLRGDYLAIVTLGFGEIIRLLLNNLTSLTGGPDGVSGIPKPTVFGIEMA 243 Query: 239 RRAP-EGMQTFHEFFGIAYNTNYKVILLYVVALLLVLLALFVINRLMRMPIGRAWEALRE 297 R A EG++TFHE G Y+ + VI LY++ALLLV LFV +RL+RMP+GRAWEALRE Sbjct: 244 RSASVEGVKTFHELLGWDYSGEHMVIFLYLLALLLVGFTLFVTSRLIRMPMGRAWEALRE 303 Query: 298 DEVACRALGLNPTIVKLSAFTIGASFAGFAGSFFAARQGLVTPESFTFIESAMILAIVVL 357 DE+ACR+LGLNPT +KLSAFT+GA+FAG G+FFAARQGLV PESFTFIESA+ILA+VVL Sbjct: 304 DEIACRSLGLNPTRIKLSAFTLGAAFAGLGGAFFAARQGLVNPESFTFIESALILAVVVL 363 Query: 358 GGMGSQLGVILAAVVMVLLQEM-RGFNEYRMLIFGLTMIVMMIWRPQGLLPMQRPHLEL 415 GGMGSQLGVILAA+++ L EM RGF EYRMLIFGL M++MM+WRPQGLLP RPH+EL Sbjct: 364 GGMGSQLGVILAAILLTALPEMARGFAEYRMLIFGLVMVLMMMWRPQGLLPASRPHVEL 422 Lambda K H 0.330 0.146 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 679 Number of extensions: 39 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 424 Length adjustment: 32 Effective length of query: 385 Effective length of database: 392 Effective search space: 150920 Effective search space used: 150920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory