Align aminomethyltransferase; EC 2.1.2.10 (characterized)
to candidate RR42_RS20060 RR42_RS20060 glycine cleavage system protein T
Query= CharProtDB::CH_000563 (364 letters) >FitnessBrowser__Cup4G11:RR42_RS20060 Length = 379 Score = 333 bits (853), Expect = 6e-96 Identities = 198/384 (51%), Positives = 241/384 (62%), Gaps = 33/384 (8%) Query: 3 QQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGSRT 62 Q TPL H ARMVDF GW MP++YGSQI+EHHAVRTDAGMFDVSHM +VDL G Sbjct: 4 QATPLNAIHRALSARMVDFGGWDMPVNYGSQIEEHHAVRTDAGMFDVSHMCVVDLNGEHV 63 Query: 63 REFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREKDL 122 R FLR LLAN+V KL GKALYS ML+ GGVIDDLIVY+F ED FRLVVN+ T D+ Sbjct: 64 RAFLRGLLANNVDKLQTPGKALYSCMLDEKGGVIDDLIVYFFAEDHFRLVVNAGTANNDI 123 Query: 123 SWITQH--AEPFGIEITVR---------DDLSMIAVQGPNAQAKAATLFNDAQRQAVEGM 171 WI A G+ IT R L+++AVQGPNA+AK F Q E + Sbjct: 124 EWIAARNAATNSGVRITPRRGDNAPDGVAPLAIVAVQGPNARAKVWNAFPSTQPS--EAL 181 Query: 172 KPFFGV-----QAGDLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDT 226 KPF V G++ +A TGYTGE G+E+ +P E A W L+ GV+P GLGARDT Sbjct: 182 KPFNAVVVQDPALGEVMVARTGYTGEDGFELVVPAENVAGLWEKLIAEGVRPAGLGARDT 241 Query: 227 LRLEAGMNLYGQEMDETISPLAANMGWTIAWEPADRDFIGREALEVQREHGTEKLVGLVM 286 LRLEAGMNLYGQ+MD SPL A + WT+ + ++RDF G+ AL + T++ VGL++ Sbjct: 242 LRLEAGMNLYGQDMDIHTSPLNAGLAWTVDLQ-SERDFTGKAALVAGGK--TQQFVGLIL 298 Query: 287 TEK-----GVLRNELPVRFTDAQGNQHEGIITSGTFSPTLGYSIALARVP--EGIGETAI 339 GVLR V T A EG ITSGTFSP+L SIA AR+P +G Sbjct: 299 RPANGKAGGVLRAHQKV-ITPA----GEGEITSGTFSPSLSQSIAFARLPLDVALGAEVQ 353 Query: 340 VQIRNREMPVKVTKPVFVRNGKAV 363 V+IR+R++ V K FVRNGKA+ Sbjct: 354 VEIRDRKLAATVVKLPFVRNGKAL 377 Lambda K H 0.320 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 437 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 364 Length of database: 379 Length adjustment: 30 Effective length of query: 334 Effective length of database: 349 Effective search space: 116566 Effective search space used: 116566 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate RR42_RS20060 RR42_RS20060 (glycine cleavage system protein T)
to HMM TIGR00528 (gcvT: glycine cleavage system T protein (EC 2.1.2.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00528.hmm # target sequence database: /tmp/gapView.7028.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00528 [M=362] Accession: TIGR00528 Description: gcvT: glycine cleavage system T protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-115 372.1 0.0 1.6e-115 371.9 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS20060 RR42_RS20060 glycine cleavage sy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS20060 RR42_RS20060 glycine cleavage system protein T # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 371.9 0.0 1.6e-115 1.6e-115 1 362 [] 3 373 .. 3 373 .. 0.89 Alignments for each domain: == domain 1 score: 371.9 bits; conditional E-value: 1.6e-115 TIGR00528 1 lkrtpLydlhtelggklvdfaGwelPvqykslieeheavrtkaGlfDvshmgkvelsGskslkfLqrll 69 l+ tpL +h l++++vdf+Gw +Pv+y+s+ieeh+avrt+aG+fDvshm v+l+G+++++fL+ ll lcl|FitnessBrowser__Cup4G11:RR42_RS20060 3 LQATPLNAIHRALSARMVDFGGWDMPVNYGSQIEEHHAVRTDAGMFDVSHMCVVDLNGEHVRAFLRGLL 71 578****************************************************************** PP TIGR00528 70 anDvdaLtk.GkaqysvllnaqGGvvDDlivykegednrfllvvnaataekDlewlkeh..leee.vtl 134 an+vd+L + Gka+ys +l +GGv+DDlivy ++ed +f+lvvna+ta+ D ew+ + ++++ v + lcl|FitnessBrowser__Cup4G11:RR42_RS20060 72 ANNVDKLQTpGKALYSCMLDEKGGVIDDLIVYFFAED-HFRLVVNAGTANNDIEWIAARnaATNSgVRI 139 *******655***************************.******************7641133331333 PP TIGR00528 135 dtlskei........sllalqGPkaktiledll.d.kaveglkefffvqeaelalkkaliartGytGed 193 + + +++a+qGP+a++ + ++ + + e+lk+f v ++ al + ++artGytGed lcl|FitnessBrowser__Cup4G11:RR42_RS20060 140 TPRRGDNapdgvaplAIVAVQGPNARAKVWNAFpStQPSEALKPFNAVVVQDPALGEVMVARTGYTGED 208 3333333577778889*******998755555414144556**************************** PP TIGR00528 194 GfeiavanekavelwkklveaygvkPiGLgarDtLrleagmaLyGqeldeeitPleaglgwvvkkerkk 262 Gfe++v+ e+ + lw+kl+++ gv+P GLgarDtLrleagm+LyGq++d +++Pl+agl w+v ++ ++ lcl|FitnessBrowser__Cup4G11:RR42_RS20060 209 GFELVVPAENVAGLWEKLIAE-GVRPAGLGARDTLRLEAGMNLYGQDMDIHTSPLNAGLAWTVDLQ-SE 275 *********************.********************************************.** PP TIGR00528 263 sdfiGravleeqkengtekklvGleml.....ekgiarnelkvlltngekevGivtsGtlsPtLgknia 326 +df G+a+l g ++ vGl + + g++r + kv+++ g +G +tsGt+sP L ++ia lcl|FitnessBrowser__Cup4G11:RR42_RS20060 276 RDFTGKAALVA---GGKTQQFVGLILRpangkAGGVLRAHQKVITPAG---EGEITSGTFSPSLSQSIA 338 *********85...455566999976422221345**********999...9***************** PP TIGR00528 327 layvdkelekiGtklevevrnklvkikvvkklfvrs 362 a+++ ++ G +++ve+r++++ + vvk +fvr+ lcl|FitnessBrowser__Cup4G11:RR42_RS20060 339 FARLPLDV-ALGAEVQVEIRDRKLAATVVKLPFVRN 373 *****776.69***********************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (362 nodes) Target sequences: 1 (379 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.77 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory