Align hydroxyacylglutathione hydrolase (EC 3.1.2.6) (characterized)
to candidate RR42_RS13570 RR42_RS13570 hydroxyacylglutathione hydrolase
Query= BRENDA::Q8ZRM2 (251 letters) >FitnessBrowser__Cup4G11:RR42_RS13570 Length = 267 Score = 183 bits (464), Expect = 4e-51 Identities = 109/268 (40%), Positives = 148/268 (55%), Gaps = 20/268 (7%) Query: 1 MNLNSIPAFQDNYIWVLTNDEGRCV-IVDPGEAAPVLKAIAEHKWMPEAIFLTHHHHDHV 59 + + IPAFQDNYIW + +G C +VDPGE+APV +A AI +THHH DH Sbjct: 2 LKVEPIPAFQDNYIWAI--HDGHCAAVVDPGESAPVEAFLAREGLTLGAIVITHHHGDHQ 59 Query: 60 GGVKELLQHFPQ------MTVYGPAETQDKGATHLVGDGDTIRVLGEKFTL--FATPGHT 111 GGV LL P + V GPA + T V +GDT+ V L PGHT Sbjct: 60 GGVAGLLAVHPTAPDGAPLPVIGPAGERIGARTVAVREGDTVNVAHPSLQLKVLDVPGHT 119 Query: 112 LGHVCYFSR-----PYLFCGDTLFSGGCGRLFEGTPSQMYQSLMKINSLPDDTLICCAHE 166 GHV Y + P +FCGDTLF+ GCGRLFEG+P+QM SL K+ +LP T + CAHE Sbjct: 120 AGHVAYVADLPGAGPSVFCGDTLFASGCGRLFEGSPAQMLSSLDKLAALPGATRVYCAHE 179 Query: 167 YTLANIKFALSILPHDSFINEYYRKVKELRVKKQMTLPVILKNERKINLFLRTEDIDLIN 226 YT +N++FA ++ PH++ + + +V LR T+P + ER++N FLR+ + + Sbjct: 180 YTRSNVRFARAVEPHNAELAAWEARVDALRAVGAPTVPTTIGQEREVNPFLRSR-VPAVR 238 Query: 227 E---INKETILQQPEARFAWLRSKKDTF 251 E + + A F LR KD F Sbjct: 239 EAVAAHAGGVAGNDAAAFGALRGWKDDF 266 Lambda K H 0.323 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 209 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 267 Length adjustment: 24 Effective length of query: 227 Effective length of database: 243 Effective search space: 55161 Effective search space used: 55161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
Align candidate RR42_RS13570 RR42_RS13570 (hydroxyacylglutathione hydrolase)
to HMM TIGR03413 (gloB: hydroxyacylglutathione hydrolase (EC 3.1.2.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03413.hmm # target sequence database: /tmp/gapView.29458.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03413 [M=248] Accession: TIGR03413 Description: GSH_gloB: hydroxyacylglutathione hydrolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-95 305.1 0.0 1.9e-95 304.9 0.0 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS13570 RR42_RS13570 hydroxyacylglutathi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS13570 RR42_RS13570 hydroxyacylglutathione hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 304.9 0.0 1.9e-95 1.9e-95 2 248 .] 5 266 .. 4 266 .. 0.94 Alignments for each domain: == domain 1 score: 304.9 bits; conditional E-value: 1.9e-95 TIGR03413 2 iaipalsdNyiwllkdekseavvvDpgeaepvlealeekglkleaillTHhHaDHvggvaellekfp.. 68 ++ipa++dNyiw+++d + a+vvDpge++pv ++l+++gl+l ai++THhH DH ggva ll+ +p lcl|FitnessBrowser__Cup4G11:RR42_RS13570 5 EPIPAFQDNYIWAIHDGH-CAAVVDPGESAPVEAFLAREGLTLGAIVITHHHGDHQGGVAGLLAVHPta 72 78****************.99*****************************************9876532 PP TIGR03413 69 .....vkvvgpaeeripgltkevkegdevel..lelevevlevpGHtlgHiayyleee...kvlFcgDt 127 ++v+gpa eri + t++v+egd+v++ +l+++vl+vpGHt+gH+ay+++ + +FcgDt lcl|FitnessBrowser__Cup4G11:RR42_RS13570 73 pdgapLPVIGPAGERIGARTVAVREGDTVNVahPSLQLKVLDVPGHTAGHVAYVADLPgagPSVFCGDT 141 2333478***********************955578999***************99656779******* PP TIGR03413 128 LfsaGCGrlfegtaeqmleslqklaaLpeetkvycaHEYtlsNlrFalavepenealkerlkevealra 196 Lf+ GCGrlfeg+++qml+sl+klaaLp +t+vycaHEYt sN+rFa+avep+n++l+++ ++v+alra lcl|FitnessBrowser__Cup4G11:RR42_RS13570 142 LFASGCGRLFEGSPAQMLSSLDKLAALPGATRVYCAHEYTRSNVRFARAVEPHNAELAAWEARVDALRA 210 ********************************************************************* PP TIGR03413 197 kgkptlPstlaeekatNpFLraeeaevkaalee....ekaeevevfaelRekkdkf 248 g pt+P+t+++e+++NpFLr + ++v++a+++ + +++++f +lR +kd+f lcl|FitnessBrowser__Cup4G11:RR42_RS13570 211 VGAPTVPTTIGQEREVNPFLRSRVPAVREAVAAhaggVAGNDAAAFGALRGWKDDF 266 *****************************9999888888999************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (267 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 5.96 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory