Align 4Fe-4S ferredoxin-type domain-containing protein (characterized, see rationale)
to candidate RR42_RS21285 RR42_RS21285 (Fe-S)-binding protein
Query= uniprot:B2TBY8 (464 letters) >FitnessBrowser__Cup4G11:RR42_RS21285 Length = 476 Score = 278 bits (712), Expect = 2e-79 Identities = 155/357 (43%), Positives = 213/357 (59%), Gaps = 8/357 (2%) Query: 31 LREKRDAQAHGIAEWETMRELASGIKEHTLSNLSQYLEQFAAAAEANGVTVHWAATAEEH 90 L+ KR Q E E +R+L I++H LS L L Q A GV VHWA TA+E Sbjct: 33 LQAKRAVQFPDGDELEQLRDLGEAIRQHALSQLPDLLVQLEDKLTAAGVQVHWAETADEA 92 Query: 91 NALVHQIMSERGMTTLVKSKSMLTDECKMREYLEPRGITVMETDLGERIQQLDHQDPSHM 150 NA+VH I R + ++K KSM ++E ++ YL RGI +E+D+GE I QL + PSH+ Sbjct: 93 NAIVHGIAQARQASRVIKGKSMASEEIELNHYLAERGIDCIESDMGEYIVQLAGEKPSHI 152 Query: 151 VVPAVHKLRADVAELFGRTIGTDPKNSDIHYLAESQRMNTRPYFVREKTAGMTGCNFAVA 210 V+PA+HK R D+AELF + I P D+ L ++ R R FV G++G NFA A Sbjct: 153 VMPAIHKTRGDIAELFEQHIPGTPYTEDVDELIQTGRRALRQEFV-NADIGLSGVNFAAA 211 Query: 211 ETGTVVVCTNEGNADLSANVPPLHIASIGIEKLIPKVSDLGVFIRMLSRSALGSPITQYT 270 +TGT+ + NEGN LS VP +HIA +G+EK++ ++ + +L+RSA G IT Y Sbjct: 212 DTGTLWLVENEGNGRLSTTVPDVHIAIMGMEKVVARLEHIVPLASLLTRSATGQAITTYF 271 Query: 271 SHFRAPRPG------TEMHFILVDHGRSERLAMEDFWYSLKCIRCGACMNTCPVYRRSGG 324 + PR E+H +L+D+GRS+ A E +L+CIRCGACMN CPVY R GG Sbjct: 272 NLISGPRRAGERDGPREVHLVLLDNGRSQAYADEQLRATLQCIRCGACMNHCPVYTRIGG 331 Query: 325 LSYGGTYSGPIGAIINP-TFDLKRYSALPFASTLNGSCTNVCPVKINIHEQIYKWRT 380 +YG TY GPIG II+P L + L AS+L G+C VCPV+I I + + + RT Sbjct: 332 HAYGTTYPGPIGKIISPHLLGLDATADLATASSLCGACGEVCPVRIPIPQLLIRLRT 388 Lambda K H 0.320 0.133 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 499 Number of extensions: 25 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 464 Length of database: 476 Length adjustment: 33 Effective length of query: 431 Effective length of database: 443 Effective search space: 190933 Effective search space used: 190933 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory