GapMind for catabolism of small carbon sources


Aligments for a candidate for prpD in Cupriavidus basilensis 4G11

Align 2-methylcitrate dehydratase; 2-MC dehydratase; Aconitate hydratase; ACN; Aconitase; EC; EC (characterized)
to candidate RR42_RS14485 RR42_RS14485 2-methylcitrate dehydratase

Query= SwissProt::Q937N6
         (484 letters)

>lcl|FitnessBrowser__Cup4G11:RR42_RS14485 RR42_RS14485
           2-methylcitrate dehydratase
          Length = 483

 Score =  847 bits (2187), Expect = 0.0
 Identities = 410/475 (86%), Positives = 442/475 (93%)









Lambda     K      H
   0.322    0.136    0.410 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 816
Number of extensions: 17
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 484
Length of database: 483
Length adjustment: 34
Effective length of query: 450
Effective length of database: 449
Effective search space:   202050
Effective search space used:   202050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)

Align candidate RR42_RS14485 RR42_RS14485 (2-methylcitrate dehydratase)
to HMM TIGR02330 (prpD: 2-methylcitrate dehydratase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02330.hmm
# target sequence database:        /tmp/gapView.12513.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02330  [M=468]
Accession:   TIGR02330
Description: prpD: 2-methylcitrate dehydratase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
   9.7e-267  871.0   0.0   1.1e-266  870.8   0.0    1.0  1  lcl|FitnessBrowser__Cup4G11:RR42_RS14485  RR42_RS14485 2-methylcitrate deh

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Cup4G11:RR42_RS14485  RR42_RS14485 2-methylcitrate dehydratase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  870.8   0.0  1.1e-266  1.1e-266       1     468 []      13     483 .]      13     483 .] 0.99

  Alignments for each domain:
  == domain 1  score: 870.8 bits;  conditional E-value: 1.1e-266
                                 TIGR02330   1 davlediadyvleyeidskeaydtaryvlldtlgcgllaleypectkllgpvvegtlvpngarvpgtsy 69 
                                               d v+ di+dyv  y+++s++aydtar++l+dtlgcgl+al yp+ctkllgp+v+gt+vpnga+vpgt++
                                               66899**************************************************************** PP

                                 TIGR02330  70 qldpvkaafnigalvrwldyndtwlaaewghpsdnlggilavadylsrkriaegkeplkvkevleamik 138
                                               qldp++aafniga++rwld+ndtwlaaewghpsdnlggila+ad+lsr+++a g++pl++k+vl+ mik
                                               ********************************************************************* PP

                                 TIGR02330 139 aheiqgvlalensfnrvgldhvllvkvastavvakllgatreeilnalshafvdgqalrtyrhapntgs 207
                                               aheiqg++alen+fn+vgldhv+lvkvastavva++lg+  +eilna+s+a+vdgqalrtyrhapntgs
                                               ********************************************************************* PP

                                 TIGR02330 208 rkswaagdatsrgvrlalialkgemgypsalsapvwgfedvlfkkeklklareygsyvmenvlfkisfp 276
                                               rkswaagdatsr+vrlalia++gemgyps+lsa  wgf+dvlfk++ ++++r+yg+yvmenvlfki+fp
                                               ********************************************************************* PP

                                 TIGR02330 277 aefhaqtaveaavklheevker...ldeierivitthesairiidkkgplanpadrdhclqylvavpll 342
                                               aefhaqtaveaa++lh ++ ++   +++i +++i+the++iriidkkgplanpadrdhc+qy+vavpll
                                               ******************988766799****************************************** PP

                                 TIGR02330 343 fgdlvaedyedavaadpridelreklevvedkrysreyleadkrsianavevffkdgskteeveveypl 411
                                               fg+l aedyed++aadprid+lr+k+++ved+r++++y+++dkrsiana++v+ +dg++  ev+v+ypl
                                               ********************************************************************* PP

                                 TIGR02330 412 ghrrrrdegipklvdkfkanlatkfsskkqerilelcldqakleatpvnefldlfvi 468
                                               gh+rrrdegip+lv+kfk+nla++f++++q+ il ++ldqa+lea+pvne++dl+vi
                                               *******************************************************97 PP

Internal pipeline statistics summary:
Query model(s):                            1  (468 nodes)
Target sequences:                          1  (483 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 11.09

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory