Align L-threonine dehydrogenase (EC 1.1.1.103) (characterized)
to candidate RR42_RS11005 RR42_RS11005 4-hydroxybutyrate dehydrogenase
Query= ecocyc::EG12293-MONOMER (383 letters) >FitnessBrowser__Cup4G11:RR42_RS11005 Length = 382 Score = 177 bits (450), Expect = 3e-49 Identities = 124/358 (34%), Positives = 184/358 (51%), Gaps = 31/358 (8%) Query: 30 GFTRTLIVTDNMLTKLGMAGDVQKALEERNIFSVIYDGTQPNPTTENVAAGLKLLKENNC 89 G R L+VTD + G+A AL + I+D T NPT V +++ C Sbjct: 28 GIRRPLVVTDKGVVAAGVAQQAIVALG--GLPHEIFDETPSNPTEAMVKKAAAQYRDSGC 85 Query: 90 DSVISLGGGSPHDCAKGIALVAANGGDIRDYEGVD----RSAKPQLPMIAINTTAGTASE 145 D +I++GGGS D AKGIA++A + G++ Y ++ R + P+IA+ TT+GT SE Sbjct: 86 DGLIAVGGGSSIDLAKGIAILATHPGELTTYATIEGGSARLTERAAPLIAVPTTSGTGSE 145 Query: 146 MTRFCIITDEARHIKMAIVDKHVTPLLSVNDSSLMIGMPKSLTAATGMDALTHAIEAYVS 205 + R II E K+ H+ P ++ D L +G+P LTAATGMDA+ H +E +++ Sbjct: 146 VARGAIIILEDGR-KLGFHSWHLLPKSAICDPGLTLGLPAGLTAATGMDAIAHCVETFLA 204 Query: 206 IAATPITDACALKAVTMIAENLPLAVEDGSNAKAREAMAYAQFLAGMAFNNASLGYVHAM 265 A P D AL + +++ A DG + AR M A MAF LG VH++ Sbjct: 205 PAFNPPADGIALDGLERGWKHIERATRDGQDRDARLNMMSASMQGAMAFQK-GLGCVHSL 263 Query: 266 AHQLGGF-----YNLPHGVCNAVLLPHVQVFNSKVAA-------ARLRDCAAAMGVNVTG 313 +H LGG L HG NAV++P V FN+ + ARLR AMG+ Sbjct: 264 SHPLGGLKVDGKTGLHHGTLNAVVMPAVLRFNADAPSVVRDNRYARLRH---AMGL---- 316 Query: 314 KNDAEGAEACINAIRELAKKVDIPAGLRDLNVKEEDFAVLATNALKDACGFTNPIQAT 371 DA+ A+ A+ ++ ++ +P GLR + V E+ F + AL D C TNP +A+ Sbjct: 317 PQDADLAQ----AVHDMTARLGLPTGLRQMGVTEDMFDKVIAGALVDHCHKTNPKEAS 370 Lambda K H 0.318 0.131 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 368 Number of extensions: 28 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 382 Length adjustment: 30 Effective length of query: 353 Effective length of database: 352 Effective search space: 124256 Effective search space used: 124256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory