Align L-threonine dehydrogenase (EC 1.1.1.103) (characterized)
to candidate RR42_RS24560 RR42_RS24560 alcohol dehydrogenase
Query= ecocyc::EG12293-MONOMER (383 letters) >FitnessBrowser__Cup4G11:RR42_RS24560 Length = 389 Score = 190 bits (482), Expect = 7e-53 Identities = 118/350 (33%), Positives = 187/350 (53%), Gaps = 3/350 (0%) Query: 35 LIVTDNMLTKLGMAGDVQKALEERNIFSVIYDGTQPNPTTENVAAGLKLLKENNCDSVIS 94 L+VTD L K G+ + +L ++D +P + ++ + D VI Sbjct: 40 LVVTDGGLHKAGVLEGAKASLAAAGFRVTVFDEVVADPPEAVLLRCVEHARAARVDLVIG 99 Query: 95 LGGGSPHDCAKGIALVAANGGDIRDYEGVDRSAKPQLPMIAINTTAGTASEMTRFCIITD 154 LGGGS D AK A++ +G + + G+ ++P++ + TTAGT SE+T I++ Sbjct: 100 LGGGSSMDIAKLAAVLVVSGQPLAEMYGIGNVKGARVPLVQMPTTAGTGSEVTNISIVS- 158 Query: 155 EARHIKMAIVDKHVTPLLSVNDSSLMIGMPKSLTAATGMDALTHAIEAYVSI-AATPITD 213 KM IV + + D+ L +G+P+ TAATG+DA+ HAIEAY S I+D Sbjct: 159 VGETTKMGIVAPQLYADRVILDAELTVGLPRQHTAATGIDAMVHAIEAYTSKHKKNAISD 218 Query: 214 ACALKAVTMIAENLPLAVEDGSNAKAREAMAYAQFLAGMAFNNASLGYVHAMAHQLGGFY 273 A A +A+ +++ NL A E+G++ AREAM LAG AF NA + VHA+A+ LGG + Sbjct: 219 ALAREALRLLSANLLPACENGNDRGAREAMLLGATLAGQAFANAPVAAVHALAYPLGGHF 278 Query: 274 NLPHGVCNAVLLPHVQVFNSKVAAARLRDCAAAMGVNVTGKNDAEGAEACINAIRELAKK 333 ++PHG+ NA++L V FN+ AAA+ + A A+G+ +D A I + +L + Sbjct: 279 HIPHGLSNALMLGPVLRFNAAAAAAQYAELAGALGIGQADGDDEARTAAFIGFMEDLMDR 338 Query: 334 VDIPAGLRDLNVKEEDFAVLATNALKDACGF-TNPIQATHEEIVAIYRAA 382 P LRD V E A+LA +A++ NP++ + + +Y A Sbjct: 339 SGAPRRLRDAGVTRESLAMLAADAMQQQRLLQNNPVEVQQADALRLYEQA 388 Lambda K H 0.318 0.131 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 389 Length adjustment: 30 Effective length of query: 353 Effective length of database: 359 Effective search space: 126727 Effective search space used: 126727 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory