GapMind for catabolism of small carbon sources

 

Aligments for a candidate for acs in Cupriavidus basilensis 4G11

Align Acetate/butyrate--CoA ligase AAE7, peroxisomal; AMP-binding protein 7; AtAMPBP7; Acetyl-CoA synthetase; Acyl-activating enzyme 7; Butyryl-CoA synthetase; Protein ACETATE NON-UTILIZING 1; EC 6.2.1.1; EC 6.2.1.2 (characterized)
to candidate RR42_RS25360 RR42_RS25360 acyl-CoA synthetase

Query= SwissProt::Q8VZF1
         (569 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS25360 RR42_RS25360 acyl-CoA
           synthetase
          Length = 554

 Score =  543 bits (1400), Expect = e-159
 Identities = 278/548 (50%), Positives = 363/548 (66%), Gaps = 19/548 (3%)

Query: 12  LPKIPANYTALTPLWFLDRAAVVHPTRKSVIHGSREYTWRQTYDRCRRLASALADRSIGP 71
           L +  AN+  LTPL FLDR A  +P R ++IHG    +W+ T +RCR+LASAL  R +G 
Sbjct: 10  LDRRAANHMPLTPLHFLDRCAEQYPDRTAIIHGPVRQSWKVTRERCRQLASALVKRGVGR 69

Query: 72  GSTVAIIAPNIPAMYEAHFGVPMCGAVLNCVNIRLNAPTVAFLLSHSQSSVIMVDQEFFT 131
           G TV+I+APN PAM EAH G+P+ GAVLN +N RL+A  V F+++H +  V+ VD+EF  
Sbjct: 70  GDTVSILAPNTPAMVEAHHGIPLSGAVLNAINCRLDADGVRFIVAHGECKVLFVDREFSA 129

Query: 132 LAEDSLRLMEEKAGSSFKRPLLIVIGDHTC-APESLNRALSKGAIEYEDFLATGDPNYPW 190
           LA ++L+ +          PL+I I D    A E +      GA+EYE FL  GD ++P 
Sbjct: 130 LAAEALQGLPNA-------PLVIDIADALAPAGEPI------GAMEYEQFLREGDIDFPG 176

Query: 191 QPPADEWQSIALGYTSGTTASPKGVVLHHRGAYIMALSNPLIWGMQDGAVYLWTLPMFHC 250
             P DEW +IAL YTSGTT+ PKGVV  HRGAY+M++     WGM     YLWTLPMFH 
Sbjct: 177 VWPDDEWNAIALNYTSGTTSDPKGVVPSHRGAYLMSMLQLTDWGMPRAPKYLWTLPMFHA 236

Query: 251 NGWCFPWSLAVLSGTSICLRQVTAKEVYSMIAKYKVTHFCAAPVVLNAIVNAPKEDTILP 310
           NGWCF W++   +GT +CLR+VTA  ++S I  Y   HFCAAP+VL+++  A +E+   P
Sbjct: 237 NGWCFSWAVTAAAGTHVCLRKVTAANIFSAIEAYGADHFCAAPIVLSSLATATQEER-RP 295

Query: 311 LPHTVHVMTAGAAPPPSVLFSMNQKGFRVAHTYGLSETYGPSTVCAWKPEWDSLPPETQA 370
             H V + TAG+ PP SVL ++ ++GF V H YG++E  G        P W+    + +A
Sbjct: 296 FSHVVRIRTAGSPPPASVLKAVIEQGFDVEHVYGITEASGTPVSSYANPAWNEKSGDEKA 355

Query: 371 KLNARQGVRYTGMEQLDVIDTQTGKPVPADGKTAGEIVFRGNMVMKGYLKNPEANKETFA 430
           +L ARQG R  G+E L V D  T + VP DG T GE++ RGN+VMKGYLKNPEA +  FA
Sbjct: 356 RLMARQGNRAAGLEGLRVADPDTMESVPWDGTTQGELLLRGNIVMKGYLKNPEATEAAFA 415

Query: 431 GGWFHSGDIAVKHPDNYIEIKDRSKDVIISGGENISSVEVENVVYHHPAVLEASVVARPD 490
           GGWFH+GD+AV HPD Y++I DRSKDVIISGGENISSVEVE+V++ HPAVL A+VVA+P 
Sbjct: 416 GGWFHTGDLAVVHPDGYVQITDRSKDVIISGGENISSVEVEDVLHQHPAVLIAAVVAQPH 475

Query: 491 ERWQESPCAFVTLKSDYEKHDQNKLAQDIMKFCREKLPAYWVPKSVVFGPLPKTATGKIQ 550
            +W ESPCAF+ LK+      +     +I+ FCR +L  Y  P  VV+G LPKT TGKIQ
Sbjct: 476 PKWGESPCAFIELKNGVAAPTE----AEIIAFCRSRLAHYKCPTRVVYGALPKTGTGKIQ 531

Query: 551 KHILRTKA 558
           K+ LR  A
Sbjct: 532 KYRLRALA 539


Lambda     K      H
   0.319    0.134    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 906
Number of extensions: 39
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 569
Length of database: 554
Length adjustment: 36
Effective length of query: 533
Effective length of database: 518
Effective search space:   276094
Effective search space used:   276094
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory