Align Putative thymidine phosphorylase; EC 2.4.2.4; TdRPase (uncharacterized)
to candidate RR42_RS21235 RR42_RS21235 thymidine phosphorylase
Query= curated2:Q6N2A3 (514 letters) >FitnessBrowser__Cup4G11:RR42_RS21235 Length = 679 Score = 380 bits (977), Expect = e-110 Identities = 209/490 (42%), Positives = 294/490 (60%), Gaps = 9/490 (1%) Query: 10 PLTIRRISLDTGRENVAVISRRSRALRPEVFRGFSRVELRINSKVLLATLMITDDDAMIG 69 PL RR+ + TG ++A +S P G +R+ +R + + A L + + A++ Sbjct: 186 PLKARRMPIATGDAHIAYVS-------PAFSAGQTRMAVRSGTVEIPAALHVVESPALLQ 238 Query: 70 PDEVGLSEPAFRRFNEPVGSAVSVTPARSPASLDAVRAKIQGHTLSAAEITAIVDDLAHF 129 +E+GLS+ F R GS V + P S D +R K++G LS AE A++ D Sbjct: 239 DEEIGLSDALFDRLGAAPGSTVRLRRIPGPVSRDVLRKKLRGDALSEAEYEAVLRDAVEG 298 Query: 130 RYSDMEIAAFLISAARFTTTDELLALVGAMASVGTKLTWDTPIVVDKHCIGGIPGNRTTM 189 RY+++E+ AFL++A++ T E++++ A ++ WD PIVVDKH +GG+PG+R T+ Sbjct: 299 RYTEIELTAFLVAASQHLTDAEVVSVARARTRFAPRIGWDEPIVVDKHSMGGVPGSRITL 358 Query: 190 IVVPIVAAHGLMIPKTSSRAITSPAGTADTMELLARVDLDVEQMKQVVHACGGCLVWGGH 249 IVVPIVAA GL +PKTSSRAITS AGTA+ ME +ARVDLD++ +++ V C+ W G Sbjct: 359 IVVPIVAAFGLAMPKTSSRAITSAAGTAEAMETVARVDLDIDDVRRCVEQARACIAWNGR 418 Query: 250 VNLSPADDILISVERPLSLDTPEQMVASIMSKKLAAGSTRLLIDFPVGPSAKVTNANEAM 309 +N S DD++ ++ RPL LDT VASI+SKK AGST +++D P GP AK+ + EA Sbjct: 419 LNHSAIDDVMNAITRPLGLDTNRWSVASILSKKYTAGSTHVIVDLPFGPQAKLKSQAEAQ 478 Query: 310 RLRKLFEFVGDHFGISVEVVTTDGRQPIGRGIGPVLEARDVMAVLGNEPGAPADLREKSL 369 L LFE VG G+ V T G +PIGRG+GP LE RDV+ VL P APADLREK+L Sbjct: 479 ALGVLFEAVGAGLGMQVRAFATHGSKPIGRGVGPALEVRDVLQVLNGSPDAPADLREKAL 538 Query: 370 RLAAHLLEYDPKLRG-GTGYARAKELLDSGAALKKMQQIIDAQGPSPCPAELGSYAADVL 428 A +L +DP + G A ELL GAA +I+ AQG P G + V Sbjct: 539 FFAGQILAFDPAVGSPAEGRRMAGELLACGAASAAFDRIVAAQGARAAPDAPGQHVHTVP 598 Query: 429 AAADGVVNGIDCLRINRLARSAGAPVAKGAGIDLFKKIGDRVEKGEPLYRVYASDRSEFD 488 A+ GVV I+ I +AR AGAP GAG+DL +GDR+ G+PL+R++A S+ + Sbjct: 599 ASTAGVVADINGFAIAGIARGAGAPRRPGAGVDLLCTVGDRLVAGQPLFRIHAQTASDLE 658 Query: 489 LALAA-AQAE 497 + A A AE Sbjct: 659 AGVRAHASAE 668 Lambda K H 0.319 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 915 Number of extensions: 36 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 514 Length of database: 679 Length adjustment: 37 Effective length of query: 477 Effective length of database: 642 Effective search space: 306234 Effective search space used: 306234 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
Align candidate RR42_RS21235 RR42_RS21235 (thymidine phosphorylase)
to HMM TIGR02645 (putative thymidine phosphorylase (EC 2.4.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02645.hmm # target sequence database: /tmp/gapView.9436.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02645 [M=493] Accession: TIGR02645 Description: ARCH_P_rylase: putative thymidine phosphorylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-137 445.2 0.3 1.6e-137 444.8 0.3 1.1 1 lcl|FitnessBrowser__Cup4G11:RR42_RS21235 RR42_RS21235 thymidine phosphory Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS21235 RR42_RS21235 thymidine phosphorylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 444.8 0.3 1.6e-137 1.6e-137 3 482 .. 189 663 .. 187 675 .. 0.95 Alignments for each domain: == domain 1 score: 444.8 bits; conditional E-value: 1.6e-137 TIGR02645 3 vrvlnidtgqekvlinskdlkeekltpqdrvevrlgkkslia..ivvssddlvesgevglseevveele 69 r++ i tg ++ ++s+ +q r+ vr+g+ ++ a vv+s l++ e+gls ++++l lcl|FitnessBrowser__Cup4G11:RR42_RS21235 189 ARRMPIATGDAHIAYVSPAFS----AGQTRMAVRSGTVEIPAalHVVESPALLQDEEIGLSDALFDRLG 253 566666666666666655443....5789***********99787889999****************** PP TIGR02645 70 ekegdlvtvtpaekpeslrairkklrgkklkkeeikaivsdivdeklsdveisafltalaingldvdei 138 + +g v + + p s +++rkklrg+ l+++e +a+++d v+ +++++e++afl+a l++ e+ lcl|FitnessBrowser__Cup4G11:RR42_RS21235 254 AAPGSTVRLRRIPGPVSRDVLRKKLRGDALSEAEYEAVLRDAVEGRYTEIELTAFLVAASQ-HLTDAEV 321 *********************************************************9876.89***** PP TIGR02645 139 ealtiamvetGetlewdrevivDkhsiGGvPGnktsllvvpivaaaGLliPktssraitsaaGtaDvve 207 + +++a + wd++++vDkhs+GGvPG +++l+vvpivaa GL +PktssraitsaaGta+ +e lcl|FitnessBrowser__Cup4G11:RR42_RS21235 322 VSVARARTRFAPRIGWDEPIVVDKHSMGGVPGSRITLIVVPIVAAFGLAMPKTSSRAITSAAGTAEAME 390 ********************************************************************* PP TIGR02645 208 vltrvelsveelkrivekvggclvWGGalnlaPaDDvlikverpLslDpeeqllasilskkiaiGstkv 276 +++rv+l +++++r ve+ +c++W G ln + DDv+ + rpL+lD++ +asilskk+ +Gst+v lcl|FitnessBrowser__Cup4G11:RR42_RS21235 391 TVARVDLDIDDVRRCVEQARACIAWNGRLNHSAIDDVMNAITRPLGLDTNRWSVASILSKKYTAGSTHV 459 ********************************************************************* PP TIGR02645 277 liDiPvGpgakvksvkeaerLakdlielgkrlgvtvevvityGsqPiGraiGPaLeakealavLesske 345 ++D+P Gp ak ks ea+ L +++ +g lg++v t+Gs+PiGr++GPaLe++++l+vL+ s++ lcl|FitnessBrowser__Cup4G11:RR42_RS21235 460 IVDLPFGPQAKLKSQAEAQALGVLFEAVGAGLGMQVRAFATHGSKPIGRGVGPALEVRDVLQVLNGSPD 528 ********************************************************************* PP TIGR02645 346 aPtsLvekslaLaaiLLemggaaer.gaGkelarelLdsGkaleklkeiieaqGgdniksedievGklk 413 aP +L+ek+l a+ +L +++a+ +G+++a elL+ G+a + +i+ aqG++ + + G+ lcl|FitnessBrowser__Cup4G11:RR42_RS21235 529 APADLREKALFFAGQILAFDPAVGSpAEGRRMAGELLACGAASAAFDRIVAAQGAR---AAPDAPGQHV 594 *********************9975378***************************9...7777889*** PP TIGR02645 414 adikaetdGyvteidnkaltriareaGaPedkgaGvklhvkvgdkvkkGdplytiyaeseekldkaial 482 ++ a+t G+v++i+ a++ iar aGaP + gaGv l vgd+ +G+pl++i+a++ + l+ + + lcl|FitnessBrowser__Cup4G11:RR42_RS21235 595 HTVPASTAGVVADINGFAIAGIARGAGAPRRPGAGVDLLCTVGDRLVAGQPLFRIHAQTASDLEAGVRA 663 ***************************************************************998865 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (493 nodes) Target sequences: 1 (679 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 14.77 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory