GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pta in Cupriavidus basilensis 4G11

Align Phosphate acetyltransferase; EC 2.3.1.8; Phosphotransacetylase (uncharacterized)
to candidate RR42_RS03805 RR42_RS03805 phosphate acetyltransferase

Query= curated2:Q9X448
         (316 letters)



>lcl|FitnessBrowser__Cup4G11:RR42_RS03805 RR42_RS03805 phosphate
           acetyltransferase
          Length = 313

 Score =  391 bits (1005), Expect = e-113
 Identities = 204/308 (66%), Positives = 241/308 (78%), Gaps = 2/308 (0%)

Query: 9   PSKYDRLIAAARAEAPAV-TIVAHPCDETSLGGAIEAAEMGLITPILVAPEAKIRNVAAE 67
           P KY  L+A  + + PA+ T VAHPCD +SLGGA++AA +GLI P+L+ PEA+IR VA  
Sbjct: 5   PDKYSVLLARCQ-DLPAIPTAVAHPCDASSLGGALQAASLGLIVPLLIGPEARIRQVADA 63

Query: 68  HRLDLGRREIVDVPHSHAAAAKAVALIREGRGELLMKGSLHTDELMHEVAASATGLRTQR 127
           + LDLG   ++DVPHSHAAAA+AVA +R G  ELLMKGSLHTDEL+HEV AS TGLRT R
Sbjct: 64  NALDLGDSVLIDVPHSHAAAARAVAAVRAGEAELLMKGSLHTDELLHEVTASTTGLRTGR 123

Query: 128 RISHVFVMDVPGHTDTLFITDAAINIFPDLEAKRDIVQNAIDLWVAIGLGEPRVAILSAV 187
           R+SHVF MDVP +   LFITDAA+NIFP L  K DI +NAIDL   +G+  P+VAILSAV
Sbjct: 124 RLSHVFAMDVPSYHKPLFITDAAVNIFPTLNDKADICRNAIDLLRVLGIERPKVAILSAV 183

Query: 188 ETVTAKIPSTIEAAALCKMAERGQITGGVLEGPLAFDNAIDQEAARIKGINSPVAGHAQI 247
           ETVT KIPSTI+AAALC M+ RGQI GG+L+GPLAFDNAI  EAA  KGI S VAG   I
Sbjct: 184 ETVTDKIPSTIDAAALCMMSRRGQIEGGILDGPLAFDNAISHEAAVTKGIVSEVAGDPDI 243

Query: 248 LVVPDLEAGNMLAKNLTFLTHADAAGLVLGARVPIVLTSRADSVRTRLASCAVAALYAAR 307
           L+VPDLEAGNMLAK LTFL  A+AAG+VLGARVPI++TSRADSVR R+ SCA+A L A  
Sbjct: 244 LLVPDLEAGNMLAKQLTFLAGAEAAGIVLGARVPIIVTSRADSVRARIGSCAIAVLLAHA 303

Query: 308 RRAAQVAA 315
           RR  Q ++
Sbjct: 304 RRTGQASS 311


Lambda     K      H
   0.320    0.133    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 287
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 316
Length of database: 313
Length adjustment: 27
Effective length of query: 289
Effective length of database: 286
Effective search space:    82654
Effective search space used:    82654
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory