Align Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 (characterized)
to candidate RR42_RS17610 RR42_RS17610 malate dehydrogenase
Query= SwissProt::P77844 (329 letters) >FitnessBrowser__Cup4G11:RR42_RS17610 Length = 774 Score = 171 bits (433), Expect = 6e-47 Identities = 102/317 (32%), Positives = 174/317 (54%), Gaps = 7/317 (2%) Query: 17 EHSHIVLPEGDDDRILMAAHQLLDQDICDITILGDPVKIKERATELGLHLNTAY---LVN 73 E IV EG+++R+L A ++D+ + + ++G P I R GL L +VN Sbjct: 459 EKKRIVFAEGEEERVLRAVQVIVDEKLANPILVGRPAVIAHRIERFGLRLRGGIDFTVVN 518 Query: 74 PLTDPRLEEFAEQFAELRKSKSVTIDEAR-EIMKDISYFGTMMVHNGDADGMVSGAANTT 132 P D R +++E + ++ + +T A+ E+ + + G M+V G+ADGM+ G +TT Sbjct: 519 PEHDARFRDYSEAYFKMMARQGITQQYAKLEMRRRTTLIGAMLVKQGEADGMICGTVSTT 578 Query: 133 AHTIKPSFQIIKTVPEASVVSSIFLMVLRGRLWAFGDCAVNPNPTAEQLGEIAVVSAKTA 192 A ++ Q++ E V +++ +VL GR D VN +PTA QL EI +++A+ Sbjct: 579 AAHLRYIDQVLGGSSE--VYAAMNGLVLPGRQIFLVDTHVNIDPTAGQLAEITLMAAEEL 636 Query: 193 AQFGIDPRVAILSYSTGNSGGGSDVDRAIDALAEARRLNPELCVDGPLQFDAAVDPGVAR 252 +FGI P+VA++S+S + + + LA R P+L VDG + D A+DP + Sbjct: 637 KRFGIVPKVALMSHSNFGTSEAPSAQKMRETLAILRERAPDLEVDGEMHGDCALDPKLRD 696 Query: 253 KKMPDSDVAGQANVFIFPDLEAGNIGYKTAQ-RTGHALAVGPILQGLNKPVNDLSRGATV 311 +PD + G+AN+ + P+++A NI Y + G+ +A+GPIL G+ PV+ L+ ATV Sbjct: 697 TLVPDGTLKGEANLLVCPNIDAANIAYNLLKVAAGNNVAIGPILLGVKAPVHILTPSATV 756 Query: 312 PDIVNTVAITAIQAGGR 328 IVN ++ + A + Sbjct: 757 RRIVNMTSLVVVDAAAK 773 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 598 Number of extensions: 39 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 774 Length adjustment: 34 Effective length of query: 295 Effective length of database: 740 Effective search space: 218300 Effective search space used: 218300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory