Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate RR42_RS22875 RR42_RS22875 ABC transporter
Query= reanno::Smeli:SMc03065 (362 letters) >FitnessBrowser__Cup4G11:RR42_RS22875 Length = 351 Score = 246 bits (628), Expect = 7e-70 Identities = 122/245 (49%), Positives = 165/245 (67%), Gaps = 1/245 (0%) Query: 7 KDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFIDGER 66 + + K + + + GIDL + E EF+V +GPSG GK+TLLR+IAGLE T GD+ + G Sbjct: 7 RSLTKRFDGTNAVDGIDLAVHEAEFLVLLGPSGSGKTTLLRLIAGLEAPTSGDILVGGRV 66 Query: 67 VNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVRGAADMLQLTPY 126 V +PP +AMVFQSYALYPH++V N+AF + R +E I R+V AA + + Sbjct: 67 VTGLPPRAHNMAMVFQSYALYPHLSVAGNIAFPLEAQRMPREAIARKVSWAAALFGIGHL 126 Query: 127 LDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLSERMSDT 186 L R P+ LSGG+RQRVA+ RA+ R P FL DEPLSNLDA LR + R E+ +L R++ T Sbjct: 127 LSRKPRQLSGGERQRVALARAVVREPVAFLLDEPLSNLDAKLRTSAREELQQLQRRLA-T 185 Query: 187 TMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIGSPAMNVIPAT 246 T IYVTHDQ+EA+ L DR+ +L G + Q+G P ++YE+PA+ FVA FIGSP MN++ Sbjct: 186 TTIYVTHDQIEALALGDRVAILDHGRVHQLGTPQQVYEQPADTFVATFIGSPPMNLVDTD 245 Query: 247 ITATG 251 TG Sbjct: 246 ALVTG 250 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 315 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 351 Length adjustment: 29 Effective length of query: 333 Effective length of database: 322 Effective search space: 107226 Effective search space used: 107226 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory