Align predicted cytochrome c component of periplasmic glucoside 3-dehydrogenase (EC 1.1.99.13) (characterized)
to candidate RR42_RS19700 RR42_RS19700 cytochrome C
Query= reanno::Cola:Echvi_1841 (141 letters) >FitnessBrowser__Cup4G11:RR42_RS19700 Length = 337 Score = 66.2 bits (160), Expect = 4e-16 Identities = 29/81 (35%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Query: 60 GLALVKESDCPSCHMVERKIVGPAYKDVAEKYESTDENIETLAKRVVDGNNGVWGQVPMP 119 G L + C +CH +RK+VGP++ +VA KY+ D + LA ++ G G WG +PMP Sbjct: 258 GAKLASQYQCMACHATDRKLVGPSFAEVARKYQGQDAQ-DALAHKIRAGGQGAWGSMPMP 316 Query: 120 AHPGLSEDDAKKMVKYILMLK 140 + + D + +V +IL K Sbjct: 317 PQAQIPDSDLRTVVGWILEAK 337 Lambda K H 0.309 0.127 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 85 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 141 Length of database: 337 Length adjustment: 22 Effective length of query: 119 Effective length of database: 315 Effective search space: 37485 Effective search space used: 37485 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory