Align MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized)
to candidate RR42_RS18590 RR42_RS18590 hypothetical protein
Query= TCDB::Q00752 (377 letters) >FitnessBrowser__Cup4G11:RR42_RS18590 Length = 359 Score = 316 bits (810), Expect = 6e-91 Identities = 180/366 (49%), Positives = 231/366 (63%), Gaps = 24/366 (6%) Query: 11 KKYPNSSHYSVEDFDLDIKNKEFIVFVGPSGCGKSTTLRMVAGLEDITKGELKIDGEVVN 70 +KY S+ + D+DI + +F V VGPSGCGKST LRM+AGLE+IT GE+ I VVN Sbjct: 10 QKYFGSTQV-IRGVDIDIADGQFTVLVGPSGCGKSTLLRMIAGLEEITTGEIAIGNRVVN 68 Query: 71 DKAPKDRDIAMVFQNYALYPHMSVYDNMAFGLKLRHYSKEAIDKRVKEAAQILGLTEFLE 130 PK+RDIAMVFQNYALYPHM+VYDNMAF LKL KE I ++V +A+ ILGL LE Sbjct: 69 RLPPKERDIAMVFQNYALYPHMTVYDNMAFSLKLAKGDKEEIKRKVAKASAILGLDSLLE 128 Query: 131 RKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVSMRAEIAKIHRRIGATTI 190 R P LSGGQRQRVAMGRAIVRD +VFL DEPLSNLDAKLRV MRAEI ++H+R+ T++ Sbjct: 129 RYPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVQMRAEIKELHQRLRTTSV 188 Query: 191 YVTHDQTEAMTLADRIVIMSSTKNEDGSGTIGRVEQVGTPQELYNRPANKFVAGFIGSPA 250 YVTHDQ EAMT+AD+IV+M GRVEQ G P LY+ P N FVAGFIGSPA Sbjct: 189 YVTHDQIEAMTMADQIVVMRD----------GRVEQRGKPLALYDHPDNLFVAGFIGSPA 238 Query: 251 MNFFDVTIK----DGHLVSKDGLTIAVTEGQLKMLESKGFKNKNLIFGIRPEDISSSLLV 306 MNF ++ D + DG + + + G + +I+G+RPE ++ + Sbjct: 239 MNFVPGVLRRSGGDAAVEFPDGTRL---PAPARFDATAGTDGQRVIYGVRPEHLTLGM-- 293 Query: 307 QETYPDATVDAEVVVSELLGSETMLYLKLGQTEFAARVDARDFHEPGEKVSLTFNVAKGH 366 P + V V E G+ T +Y + + EF + R G+ ++L + H Sbjct: 294 ----PGQGLQTRVSVVEPTGANTEIYSRFCEAEFISIFRERHDFAAGDILNLVPDHQHTH 349 Query: 367 FFDAET 372 FDA++ Sbjct: 350 LFDADS 355 Lambda K H 0.318 0.135 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 359 Length adjustment: 30 Effective length of query: 347 Effective length of database: 329 Effective search space: 114163 Effective search space used: 114163 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory