Align TreT, component of Trehalose porter (characterized)
to candidate RR42_RS12965 RR42_RS12965 glycerol-3-phosphate transporter permease
Query= TCDB::Q97ZC2 (275 letters) >FitnessBrowser__Cup4G11:RR42_RS12965 Length = 293 Score = 111 bits (278), Expect = 2e-29 Identities = 84/268 (31%), Positives = 135/268 (50%), Gaps = 12/268 (4%) Query: 9 FLLVLPALAYVISFAFFPTIEAVYLSF--QDPHG----GFSLYNYKEL-SYFNLSSAIIN 61 +LLVLP +A + F F+P +A+Y S QD G L N+++L S +A Sbjct: 14 YLLVLPQMAVTLIFFFWPAGQALYQSVLRQDAFGIDLQFVGLENFRDLFSDAQYLNAFRV 73 Query: 62 TIVVTIGALAIQLALGFLVASVLSREFFGKRALSTITIIPMGIATVVAAVTFSFVFQTSG 121 T V +G + L + ++A R G + I P +A VA V + F+F + Sbjct: 74 TGVFAVGVTLVGLTVSLMLAYFADRVVRGASGYKMLLIWPYAVAPAVAGVLWMFMFNPTL 133 Query: 122 GYANTILHSLFGLNVNWYQSSISSLLVVMIADSWKNTPIVALILLAGMSSIPKELYYASA 181 G + LH FG++ N+ +S ++L+V++ +WK L LAG+ SIPK L A+A Sbjct: 134 GVVSYALHR-FGVDWNFLLNSNQAMLLVVLIAAWKQISYNFLFFLAGLQSIPKSLIEAAA 192 Query: 182 IDGAGPIRRFFYITLPNLRSFIGISLILRGVQE-FNIFA-LPLILIGEHPPLLTTLIYDL 239 IDGAGP RRF+ I P L +++ V F+ FA + + G TL+Y + Sbjct: 193 IDGAGPWRRFWSIIFPLLSPTTFFLMVINVVYAFFDTFAIIDAVTHGGPVNATNTLVYKV 252 Query: 240 YTTTFP--EVGLALASATILLGFILVFS 265 Y F ++G + A + +L+G ++V + Sbjct: 253 YQDGFRGLDIGGSAAQSVVLMGIVIVLT 280 Lambda K H 0.328 0.143 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 205 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 293 Length adjustment: 26 Effective length of query: 249 Effective length of database: 267 Effective search space: 66483 Effective search space used: 66483 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory