Align Acetaldehyde dehydrogenase; Acetaldehyde dehydrogenase [acetylating]; EC 1.2.1.10 (characterized)
to candidate RR42_RS05100 RR42_RS05100 acetaldehyde dehydrogenase
Query= SwissProt::Q9KWS1 (316 letters) >FitnessBrowser__Cup4G11:RR42_RS05100 Length = 321 Score = 445 bits (1144), Expect = e-130 Identities = 225/305 (73%), Positives = 256/305 (83%) Query: 2 SDDRLSVAIIGSGNIGTDLMIKIMRNSKLLKVGAMVGIDPKSDGLARAQRLGVPTTAEGV 61 S RL AIIGSGNIGTDLMIKI+R+ + L+VGAMVGID SDGLARAQRLGVPTT EG+ Sbjct: 5 SRTRLRAAIIGSGNIGTDLMIKILRHGQHLEVGAMVGIDAASDGLARAQRLGVPTTHEGI 64 Query: 62 DGLLDMPAFRDIKIAFDATSAGAQAIHNQKLQAHGVRVIDLTPAAIGPYVIPVVNFDQHV 121 +GLL MP F DI++AFDATSAGA HN LQ HG++VIDLTPAAIGPYV+PVVN D H+ Sbjct: 65 EGLLGMPGFADIRVAFDATSAGAHMHHNAVLQKHGIQVIDLTPAAIGPYVVPVVNLDAHL 124 Query: 122 DAPNINMVTCGGQATIPIVHAVSKVSPVHYAEIVASISSKSAGPGTRANIDEFTETTSKA 181 DAPN+NMVTCGGQATIPIV AVS+V+PV YAEIVASI+S+SAGPGTRANIDEFTETTS A Sbjct: 125 DAPNLNMVTCGGQATIPIVRAVSQVAPVSYAEIVASIASRSAGPGTRANIDEFTETTSNA 184 Query: 182 ILEVGGAAQGRAIIILNPAEPPLIMRDTVYCFVSAEANIDAITDSVEQMVKSVQEYVPGY 241 I++VGGAA G+AII+LNPAEPPL+MRDTV+C +A+A DAI SVE+MV V YVPGY Sbjct: 185 IVQVGGAAHGKAIIVLNPAEPPLLMRDTVFCLTAADAGQDAIRASVERMVAQVAAYVPGY 244 Query: 242 RLKQKVQFEKIVAGNEQNIPGLGWSTGLKVSVFLEVEGAGHYLPSYAGNLDIMTSAGLTV 301 RLKQ VQFE+I +PG+G GLKVSVFLEVEGA HYLP+YAGNLDIMTSA L Sbjct: 245 RLKQHVQFERIDPACPLTLPGIGRLAGLKVSVFLEVEGAAHYLPAYAGNLDIMTSAALAA 304 Query: 302 AERIA 306 AER+A Sbjct: 305 AERVA 309 Lambda K H 0.317 0.134 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 321 Length adjustment: 27 Effective length of query: 289 Effective length of database: 294 Effective search space: 84966 Effective search space used: 84966 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate RR42_RS05100 RR42_RS05100 (acetaldehyde dehydrogenase)
to HMM TIGR03215 (acetaldehyde dehydrogenase (acetylating) (EC 1.2.1.10))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03215.hmm # target sequence database: /tmp/gapView.1082.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03215 [M=285] Accession: TIGR03215 Description: ac_ald_DH_ac: acetaldehyde dehydrogenase (acetylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-144 465.9 3.4 2.7e-144 465.7 3.4 1.0 1 lcl|FitnessBrowser__Cup4G11:RR42_RS05100 RR42_RS05100 acetaldehyde dehydr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Cup4G11:RR42_RS05100 RR42_RS05100 acetaldehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 465.7 3.4 2.7e-144 2.7e-144 1 284 [. 8 313 .. 8 314 .. 0.99 Alignments for each domain: == domain 1 score: 465.7 bits; conditional E-value: 2.7e-144 TIGR03215 1 kvkvaiiGsGnigtdllikllr.sevlelallvGidpesdGlararelgvetsaeGvdalleee...di 65 ++++aiiGsGnigtdl+ik+lr +++le+ ++vGid++sdGlara++lgv t++eG+++ll ++ di lcl|FitnessBrowser__Cup4G11:RR42_RS05100 8 RLRAAIIGSGNIGTDLMIKILRhGQHLEVGAMVGIDAASDGLARAQRLGVPTTHEGIEGLLGMPgfaDI 76 5799******************99***************************************9999** PP TIGR03215 66 divfdatsakahaenaklleelgkividltPaavGpyvvPavnleevldaknvnlvtCgGqatiPivaa 134 +++fdatsa ah++++++l+++g++vidltPaa+GpyvvP+vnl+++lda+n+n+vtCgGqatiPiv a lcl|FitnessBrowser__Cup4G11:RR42_RS05100 77 RVAFDATSAGAHMHHNAVLQKHGIQVIDLTPAAIGPYVVPVVNLDAHLDAPNLNMVTCGGQATIPIVRA 145 ********************************************************************* PP TIGR03215 135 vsrvakvkyaeivasiasksaGpgtranideftettskaleqvgGakkgkaiiilnPaePpllmrdtvy 203 vs+va+v+yaeivasias+saGpgtranideftetts+a+ qvgGa++gkaii+lnPaePpllmrdtv+ lcl|FitnessBrowser__Cup4G11:RR42_RS05100 146 VSQVAPVSYAEIVASIASRSAGPGTRANIDEFTETTSNAIVQVGGAAHGKAIIVLNPAEPPLLMRDTVF 214 ********************************************************************* PP TIGR03215 204 alv.eeadeeaieasveemveevqkyvpGyrlkqevvld.................gekvsvlleveGa 254 +l+ ++a ++ai+asve+mv++v++yvpGyrlkq+v+++ g kvsv+leveGa lcl|FitnessBrowser__Cup4G11:RR42_RS05100 215 CLTaADAGQDAIRASVERMVAQVAAYVPGYRLKQHVQFEridpacpltlpgigrlaGLKVSVFLEVEGA 283 **988999************************************************************* PP TIGR03215 255 gdylPkyaGnldiltaaalavaeklaeell 284 ++ylP+yaGnldi+t+aala+ae++a++ l lcl|FitnessBrowser__Cup4G11:RR42_RS05100 284 AHYLPAYAGNLDIMTSAALAAAERVARHKL 313 **************************9875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (321 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.77 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory