Align electron transfer component of the anthranilate 1,2-dioxygenase system (EC 1.14.12.1) (characterized)
to candidate RR42_RS32665 RR42_RS32665 phenol hydroxylase
Query= reanno::WCS417:GFF4631 (335 letters) >FitnessBrowser__Cup4G11:RR42_RS32665 Length = 355 Score = 161 bits (408), Expect = 2e-44 Identities = 111/332 (33%), Positives = 162/332 (48%), Gaps = 16/332 (4%) Query: 12 GKTLFFPVGANEILLDAALRNGIKIPLDCREGVCGTCQGRCESGDYSQDYVDEEALSSLD 71 G+T+ P+ A + +LDA LRNG+ +P C G+C TC+ + G++ AL + Sbjct: 10 GQTI--PIAAGQTVLDACLRNGVWLPHACCHGLCATCKVQVVEGEFEHGEASSFALMDFE 67 Query: 72 LQQRKMLSCQTRVKSDATFYFDFDSSLCNAPGPVQVKGTVSAVEQVSASTAI----LQVQ 127 + L+C +SD D + ++ G VE + + I L+V+ Sbjct: 68 RDSGQCLACCATAQSDMVIEADIEED-ADSLGLPLADYRAEVVEARALTPTIRGIWLRVK 126 Query: 128 LDQALDFLPGQYARLSVPGTDSWRSYSFANLPGNHL-QFLVRLLPDGVMSNYLRERCQVG 186 A F GQY L VPG D R++S AN PG+ L + VR + G + YL +R VG Sbjct: 127 GGAAAAFQAGQYLNLHVPGCDQPRAFSLANRPGDDLVELHVRRVEGGQATGYLHDRLSVG 186 Query: 187 DELLMEAPLGAFYLRHVTQ-PLVLVAGGTGLSALLGMLDQLAANGCEQPVHLYYGVRGAE 245 DEL AP G F++R Q P++ +AGG+GLS+ M+ + A G P+ L G R Sbjct: 187 DELGFSAPYGRFFVRKSAQKPMLFLAGGSGLSSPRAMILDMLAAGETLPITLVQGARNRT 246 Query: 246 DLCEAARIRAYAAKIPNLRYTEVLS-APSEE-WSGKRGYLTEHFDLAELRDGSADM---- 299 +L RA A PN RY LS P++ W G RGY+ + +AD Sbjct: 247 ELYYDEAFRALAGAHPNFRYVPALSDVPADSGWDGARGYVHDVLHGLYADGATADFRGHK 306 Query: 300 -YLCGPPPMVESIQQWLADQALDGVQLYYEKF 330 YLCGPPPM+E+ + L L ++ EKF Sbjct: 307 AYLCGPPPMIEACIRTLMQGRLFEEDIHTEKF 338 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 355 Length adjustment: 29 Effective length of query: 306 Effective length of database: 326 Effective search space: 99756 Effective search space used: 99756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory